DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tok and he1.1

DIOPT Version :9

Sequence 1:NP_001287510.1 Gene:tok / 42944 FlyBaseID:FBgn0004885 Length:1464 Species:Drosophila melanogaster
Sequence 2:NP_001038639.1 Gene:he1.1 / 569018 ZFINID:ZDB-GENE-021211-3 Length:263 Species:Danio rerio


Alignment Length:188 Identity:72/188 - (38%)
Similarity:103/188 - (54%) Gaps:11/188 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   534 IPYEIDGNFSGIHKALFKLAMRHWENSTCIKFVERDPEIHPNYIVFTVRSCGCCSFVGKRGNGPQ 598
            :||.:.|.||...|::...|:..:...|||:||.|  .|..:|:....:. ||.|.:|:.| |.|
Zfish    86 VPYVVSGEFSINDKSVIANAISIFHAQTCIRFVPR--SIQADYLSIENKD-GCYSAIGRTG-GKQ 146

  Fly   599 AISIGR-NCDKFGIVVHELGHVVGFWHEHTRPDREKHVVIEHNNIMKGQDYNFNMLSPDEVDSLG 662
            .:|:.| .|...||..|||.|.:||:||.:|.||:::|.|..|||..|..|||   ...:.::..
Zfish   147 VVSLNRKGCVYSGIAQHELNHALGFYHEQSRSDRDQYVRINWNNISPGMAYNF---LKQKTNNQN 208

  Fly   663 MAYDYDSIMHYARNTFSKGTYLDTILPIEMKGRKRPEIGQRLRLSQGDIAQANLLYKC 720
            ..|||.|:|||.:..|:....|:||.||.   .:..:||||..||:.||.:.|.||.|
Zfish   209 TPYDYGSLMHYGKTAFAIQPGLETITPIP---DENVQIGQRQGLSKIDILRINKLYGC 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tokNP_001287510.1 ZnMc_BMP1_TLD 520..721 CDD:239808 72/188 (38%)
Astacin 527..721 CDD:279708 72/188 (38%)
CUB 723..836 CDD:294042
CUB 840..951 CDD:278839
FXa_inhibition 958..993 CDD:291342
CUB 997..1111 CDD:278839
FXa_inhibition 1118..1153 CDD:291342
CUB 1158..1267 CDD:278839
CUB 1271..1390 CDD:238001
he1.1NP_001038639.1 ZnMc_hatching_enzyme 81..263 CDD:239810 71/186 (38%)
Astacin 86..263 CDD:279708 71/186 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.