DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tok and pcolcea

DIOPT Version :9

Sequence 1:NP_001287510.1 Gene:tok / 42944 FlyBaseID:FBgn0004885 Length:1464 Species:Drosophila melanogaster
Sequence 2:NP_001025352.2 Gene:pcolcea / 563867 ZFINID:ZDB-GENE-041014-370 Length:479 Species:Danio rerio


Alignment Length:275 Identity:90/275 - (32%)
Similarity:127/275 - (46%) Gaps:44/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   840 CGGELSVDDAVGRLESPNYPLDYLPNKECVWKITVPESYQVALKFQSFEVENHDSCVYDYVEVRD 904
            |||:|..|.  |.:.|..:|..|.||.:|.|.|||||...|.|.|:.|::|....|.||||:|.:
Zfish    35 CGGDLVGDS--GFVGSEGFPSFYKPNSKCTWYITVPEGNVVMLSFRIFDLEADPLCRYDYVDVYN 97

  Fly   905 GPGQDAPLIGVFCGYKPPPNMKSSGNSMYVKFVSDTSVQKAGFSAVFMKEVDECETQNHGCEHEC 969
            |.......:|.|||...|..:.|:.|:|.|:.|||:.....||.|.|.                 
Zfish    98 GHSNMVQKLGRFCGTFRPGALISTSNTMMVEMVSDSGTGGRGFVAYFN----------------- 145

  Fly   970 INTLGGYECSCRIGFELHSDKKHCED--ACGGVIEYPNGTITSPSFPEM-YPLLKECIWEIVAPP 1031
                ||              |.|.::  .|||.:....|||.:|::||. ||....|.|.|...|
Zfish   146 ----GG--------------KPHVDEHQFCGGKLTKSQGTIKTPNWPEKNYPPGISCSWLITVEP 192

  Fly  1032 KHRISLNFTHFDLEGTAHQQSDCGYDSVTVYSKLGENRLKRIGTFCGSSIPPTATSESNALRLEF 1096
            :..|.:.|..||||...:    |.:|.|..::...::..:|||.:||.:.|....:.||.|.::|
Zfish   193 EMVIEVKFDKFDLESDTY----CRFDYVAFFNGGEKDDSRRIGKYCGYTAPQNIVTNSNVLLVQF 253

  Fly  1097 HSDKSIQRSGFAAVF 1111
            .||.|:...||.|.:
Zfish   254 VSDLSVTSDGFMASY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tokNP_001287510.1 ZnMc_BMP1_TLD 520..721 CDD:239808
Astacin 527..721 CDD:279708
CUB 723..836 CDD:294042
CUB 840..951 CDD:278839 45/110 (41%)
FXa_inhibition 958..993 CDD:291342 3/34 (9%)
CUB 997..1111 CDD:278839 40/114 (35%)
FXa_inhibition 1118..1153 CDD:291342
CUB 1158..1267 CDD:278839
CUB 1271..1390 CDD:238001
pcolceaNP_001025352.2 CUB 35..144 CDD:238001 45/110 (41%)
CUB 157..270 CDD:238001 40/116 (34%)
NTR_PCOLCE 355..479 CDD:239631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.