DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tok and pcolce2

DIOPT Version :9

Sequence 1:NP_001287510.1 Gene:tok / 42944 FlyBaseID:FBgn0004885 Length:1464 Species:Drosophila melanogaster
Sequence 2:NP_001005804.1 Gene:pcolce2 / 448281 XenbaseID:XB-GENE-1015978 Length:416 Species:Xenopus tropicalis


Alignment Length:312 Identity:103/312 - (33%)
Similarity:141/312 - (45%) Gaps:59/312 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   840 CGGELSVDDAVGRLESPNYPLDYLPNKECVWKITVPESYQVALKFQSFEVENHDSCVYDYVEVRD 904
            |||.|:.|  .|.|.|..:|..|.||.:|.|||||||...|.|.|:..::|:.:.|.||:|:|.:
 Frog    34 CGGNLTGD--TGVLGSEGFPGVYPPNSKCTWKITVPEGKVVVLSFRFIDLESDNLCRYDFVDVYN 96

  Fly   905 GPGQDAPLIGVFCGYKPPPNMKSSGNSMYVKFVSDTSVQKAGFSAVFMKEVDECETQNHGCEHEC 969
            | ..:...||.|||...|..:.|:.|.|.|:.:||.:....||.|||    ...|....|.::  
 Frog    97 G-HSNVHRIGRFCGTFRPGALVSNSNKMLVQMISDANTAGNGFIAVF----SAAEPNERGDQY-- 154

  Fly   970 INTLGGYECSCRIGFELHSDKKHCEDACGGVIEYPNGTITSPSFPEM-YPLLKECIWEIVAPPKH 1033
                                       |||.::.|:|:..:|::||. ||....|.|.||||...
 Frog   155 ---------------------------CGGRLDKPSGSFQTPNWPERDYPAGVTCSWHIVAPKHQ 192

  Fly  1034 RISLNFTHFDLEGTAHQQSDCGYDSVTVYSKLGENRLKRIGTFCGSSIPPTATSESNALRLEFHS 1098
            .|.|.|..||:|    :.:.|.||.|.|::....|..||||.|||.|.|....||.|.|.::|.|
 Frog   193 VIELKFEKFDVE----RDNYCRYDYVAVFNGGEINDAKRIGKFCGDSPPAPIVSERNELLIQFLS 253

  Fly  1099 DKSIQRSGFAAVF-----------FTDIDECAVNNGG-------CQHECRNT 1132
            |.|:...||.|.:           .:.|...|.....       ||.:|:.|
 Frog   254 DLSLTADGFKAHYRFRPKKLPTTTVSPITTPAATTPSLKPTLALCQQKCKRT 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tokNP_001287510.1 ZnMc_BMP1_TLD 520..721 CDD:239808
Astacin 527..721 CDD:279708
CUB 723..836 CDD:294042
CUB 840..951 CDD:278839 45/110 (41%)
FXa_inhibition 958..993 CDD:291342 2/34 (6%)
CUB 997..1111 CDD:278839 48/114 (42%)
FXa_inhibition 1118..1153 CDD:291342 5/22 (23%)
CUB 1158..1267 CDD:278839
CUB 1271..1390 CDD:238001
pcolce2NP_001005804.1 CUB 34..144 CDD:238001 47/116 (41%)
CUB 155..266 CDD:366096 48/114 (42%)
NTR_PCOLCE 293..416 CDD:239631 4/13 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.