DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tok and ASTL

DIOPT Version :9

Sequence 1:NP_001287510.1 Gene:tok / 42944 FlyBaseID:FBgn0004885 Length:1464 Species:Drosophila melanogaster
Sequence 2:XP_011509507.1 Gene:ASTL / 431705 HGNCID:31704 Length:436 Species:Homo sapiens


Alignment Length:272 Identity:90/272 - (33%)
Similarity:128/272 - (47%) Gaps:57/272 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   481 SPPGFNQSQQAQQQSVPEMD--LLKAETSKDE--------EPLRHRVARAVTAKKERIWDYG--- 532
            :|.|   :|.:..:.:|.::  |:..||.:..        .|...|:..|.:.|    |..|   
Human    48 TPEG---TQASGDKDIPAINQGLILEETPESSFLIEGDIIRPSPFRLLSATSNK----WPMGGSG 105

  Fly   533 --VIPYEIDGNFSGIHKALFKLAMRHWENSTCIKFV----ERD-PEIHPNYIVFTVRSCGCCSFV 590
              .:|:.:...:....:.:...|:..:|.||||:||    :|| ..|.|.|        ||.|.|
Human   106 VVEVPFLLSSKYDEPSRQVILEALAEFERSTCIRFVTYQDQRDFISIIPMY--------GCFSSV 162

  Fly   591 GKRGNGPQAISIGRNC--DKFGIVVHELGHVVGFWHEHTRPDREKHVVIEHNNIMKGQDYNF--- 650
            |:.| |.|.:|:...|  ...|||:|||.||:||||||||.||::::.:..|.|:.|.:.||   
Human   163 GRSG-GMQVVSLAPTCLQKGRGIVLHELMHVLGFWHEHTRADRDRYIRVNWNEILPGFEINFIKS 226

  Fly   651 ---NMLSPDEVDSLGMAYDYDSIMHYARNTFSKGTYLDTILPIEMKGRKRPEIGQRLRLSQGDIA 712
               |||:|         |||.|:|||.|..||: ..|.||.|:   ......||||..||..||.
Human   227 QSSNMLTP---------YDYSSVMHYGRLAFSR-RGLPTITPL---WAPSVHIGQRWNLSASDIT 278

  Fly   713 QANLLYKCPKCG 724
            :...||.|...|
Human   279 RVLKLYGCSPSG 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tokNP_001287510.1 ZnMc_BMP1_TLD 520..721 CDD:239808 79/218 (36%)
Astacin 527..721 CDD:279708 77/211 (36%)
CUB 723..836 CDD:294042 1/2 (50%)
CUB 840..951 CDD:278839
FXa_inhibition 958..993 CDD:291342
CUB 997..1111 CDD:278839
FXa_inhibition 1118..1153 CDD:291342
CUB 1158..1267 CDD:278839
CUB 1271..1390 CDD:238001
ASTLXP_011509507.1 Astacin 97..288 CDD:279708 79/216 (37%)
ZnMc 105..286 CDD:294052 75/202 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.