Sequence 1: | NP_001287510.1 | Gene: | tok / 42944 | FlyBaseID: | FBgn0004885 | Length: | 1464 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011509507.1 | Gene: | ASTL / 431705 | HGNCID: | 31704 | Length: | 436 | Species: | Homo sapiens |
Alignment Length: | 272 | Identity: | 90/272 - (33%) |
---|---|---|---|
Similarity: | 128/272 - (47%) | Gaps: | 57/272 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 481 SPPGFNQSQQAQQQSVPEMD--LLKAETSKDE--------EPLRHRVARAVTAKKERIWDYG--- 532
Fly 533 --VIPYEIDGNFSGIHKALFKLAMRHWENSTCIKFV----ERD-PEIHPNYIVFTVRSCGCCSFV 590
Fly 591 GKRGNGPQAISIGRNC--DKFGIVVHELGHVVGFWHEHTRPDREKHVVIEHNNIMKGQDYNF--- 650
Fly 651 ---NMLSPDEVDSLGMAYDYDSIMHYARNTFSKGTYLDTILPIEMKGRKRPEIGQRLRLSQGDIA 712
Fly 713 QANLLYKCPKCG 724 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tok | NP_001287510.1 | ZnMc_BMP1_TLD | 520..721 | CDD:239808 | 79/218 (36%) |
Astacin | 527..721 | CDD:279708 | 77/211 (36%) | ||
CUB | 723..836 | CDD:294042 | 1/2 (50%) | ||
CUB | 840..951 | CDD:278839 | |||
FXa_inhibition | 958..993 | CDD:291342 | |||
CUB | 997..1111 | CDD:278839 | |||
FXa_inhibition | 1118..1153 | CDD:291342 | |||
CUB | 1158..1267 | CDD:278839 | |||
CUB | 1271..1390 | CDD:238001 | |||
ASTL | XP_011509507.1 | Astacin | 97..288 | CDD:279708 | 79/216 (37%) |
ZnMc | 105..286 | CDD:294052 | 75/202 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |