DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tok and CG10280

DIOPT Version :9

Sequence 1:NP_001287510.1 Gene:tok / 42944 FlyBaseID:FBgn0004885 Length:1464 Species:Drosophila melanogaster
Sequence 2:NP_001246942.1 Gene:CG10280 / 40740 FlyBaseID:FBgn0037395 Length:362 Species:Drosophila melanogaster


Alignment Length:245 Identity:76/245 - (31%)
Similarity:116/245 - (47%) Gaps:46/245 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   512 PLRHRVARAVTAKKERIWDYGVIPYEIDGNFSGIHKALFKLAMRHWENSTCIKFVERDPEIHPNY 576
            |:||         .:|:|..|.||:||...::...:.....|::.:.:.||:.||..|.|: .:|
  Fly   141 PMRH---------PKRLWPNGTIPFEISPRYANQERQAIIQAVKTFNSLTCVHFVPYDGEV-DDY 195

  Fly   577 IVF---TVRSCGCCSFVGKRGNGPQAISIGR------NC-DKFGIVVHELGHVVGFWHEHTRPDR 631
            ::.   .....||.|:||:|| |.|.:|:.|      :| ...|.::|||.|.:|.:||.:|.||
  Fly   196 LLIEPPLEGPQGCWSYVGRRG-GEQVVSLQRPDENSAHCFSSEGRIMHELMHAIGIYHEQSRADR 259

  Fly   632 EKHVVIEHNNIMKGQDYNFNMLSPDEVDSLGMAYDYDSIMHYARNTFSKGTYLDTILPIEMKGRK 696
            :..|.|..:||:.....||.::|..: ......|||:|:|||....|||           .||.|
  Fly   260 DNFVKIHWDNIVPRFRKNFKLVSKKK-GKYAFDYDYNSVMHYGEFYFSK-----------RKGEK 312

  Fly   697 ------RP--EIGQRLRLSQGDIAQANLLYKC-----PKCGRTFQESSGI 733
                  :|  .||||..:|:.|..:.|.||.|     .|..|:|....|:
  Fly   313 PTMTPLQPGVRIGQRKTISKIDCLKINELYGCLQGRRAKMYRSFCHLLGL 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tokNP_001287510.1 ZnMc_BMP1_TLD 520..721 CDD:239808 69/223 (31%)
Astacin 527..721 CDD:279708 69/216 (32%)
CUB 723..836 CDD:294042 3/11 (27%)
CUB 840..951 CDD:278839
FXa_inhibition 958..993 CDD:291342
CUB 997..1111 CDD:278839
FXa_inhibition 1118..1153 CDD:291342
CUB 1158..1267 CDD:278839
CUB 1271..1390 CDD:238001
CG10280NP_001246942.1 Astacin 147..344 CDD:279708 68/210 (32%)
ZnMc_astacin_like 151..342 CDD:239807 64/204 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444851
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.