DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tok and nas-23

DIOPT Version :9

Sequence 1:NP_001287510.1 Gene:tok / 42944 FlyBaseID:FBgn0004885 Length:1464 Species:Drosophila melanogaster
Sequence 2:NP_001022281.1 Gene:nas-23 / 3565992 WormBaseID:WBGene00003542 Length:537 Species:Caenorhabditis elegans


Alignment Length:320 Identity:86/320 - (26%)
Similarity:145/320 - (45%) Gaps:56/320 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   534 IPYEIDGNFSGIHKALFKLAMRHWENSTCIKFVERDPEIHPNYIVFTVRSCGCCSFVGK-RGNGP 597
            :|:|:.|:.|...::....||..||..||:.|.:|..|  ..|::.:.:..||.|.||: ...|.
 Worm   128 VPFELHGSLSAKSRSSLVAAMAFWEKHTCVAFKKRTSE--KVYLLMSGQEEGCWSTVGRDEAQGA 190

  Fly   598 QAISIGRNCDKFGIVVHELGHVVGFWHEHTRPDREKHVVIEHNNIMKGQDYNFNMLSPDEVDSLG 662
            |.::||..|:.|||..||:.|.:|.:||.:|.||:.:|.|..:.|.:...|:|.::....:::.|
 Worm   191 QILNIGTGCEMFGITSHEIAHALGLFHEQSRYDRDNYVQIVKSRIAQTNFYDFAVVGKKNMETYG 255

  Fly   663 MAYDYDSIMHYARNTFSKGTYLD---TILPIEMKGRKRPEIGQRLRLSQGDIAQANLLYKCPK-- 722
            ..||..|:|||....||    ||   :|:..::  ..:..:||....|..|:|:.|..|.|.|  
 Worm   256 QKYDIGSVMHYRPTEFS----LDGGNSIIAKDV--NMQNTMGQFRGPSFIDVAKINRHYNCEKNC 314

  Fly   723 ---------------------C--GRTFQESSGIFA-SPSHYTAGALSNETEH------------ 751
                                 |  |....:..||.| ||:..|...::.||:.            
 Worm   315 KNKITCLNGGYQHPKNCKICVCPPGYGGSDCKGIEASSPAKCTGVLVAGETQRKFTANIKPNKNA 379

  Fly   752 -----CEWRITATYGERVELKLENMNIFKSNNCETDYLEIRDGYFEKSPLIGRFCGKVDK 806
                 |.:.|.|..|:|:.:.::::.......|..:.:|:: .|.:|:....|||.|:.|
 Worm   380 KGIRKCNYHIEAPPGKRIVIIVDSVIGNCVQGCYEEGVELK-MYEDKTVTGARFCCKLQK 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tokNP_001287510.1 ZnMc_BMP1_TLD 520..721 CDD:239808 60/190 (32%)
Astacin 527..721 CDD:279708 60/190 (32%)
CUB 723..836 CDD:294042 24/104 (23%)
CUB 840..951 CDD:278839
FXa_inhibition 958..993 CDD:291342
CUB 997..1111 CDD:278839
FXa_inhibition 1118..1153 CDD:291342
CUB 1158..1267 CDD:278839
CUB 1271..1390 CDD:238001
nas-23NP_001022281.1 Astacin 122..310 CDD:279708 60/189 (32%)
ZnMc_astacin_like 128..308 CDD:239807 59/187 (32%)
CUB 384..454 CDD:294042 14/56 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.