DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tok and CG6696

DIOPT Version :10

Sequence 1:NP_476879.1 Gene:tok / 42944 FlyBaseID:FBgn0004885 Length:1464 Species:Drosophila melanogaster
Sequence 2:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster


Alignment Length:261 Identity:77/261 - (29%)
Similarity:127/261 - (48%) Gaps:29/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   469 RRGQSTTQYVNHSPPGFNQSQQAQQQSVPE-MDLLKAETSKDEEPLRHRVARAVTAKKERI-WDY 531
            |.|.:......|:.|.||...:....::.| ..|.:.:.....|.||:.:.      .||: |..
  Fly    49 RWGANMQMLRRHNSPAFNFWTEDSDTNIWEHCGLFEGDIMLHRELLRNGLL------NERLTWPE 107

  Fly   532 GVIPYEID-GNFSGIHKALFKLAMRHWENSTCIKF--VERDPE----IHPNYIVFTVRSCGCCSF 589
            ..:|:.|| .:|:.....:...|.:.:.:.|||:|  .|:..:    |..||       .||.|.
  Fly   108 AAVPFYIDPQDFNANQTMVILKAFKEYHDRTCIRFRPYEQGDKHWLLIKGNY-------SGCWSS 165

  Fly   590 VGKRGNGPQAISIGR-NCDKFGIVVHELGHVVGFWHEHTRPDREKHVVIEHNNIMKGQDYNFNML 653
            ||:|..| |.:::.. .|...|:|||||.|.:||:|:.:..:|:::|.|...||:.|..:|||..
  Fly   166 VGRRSGG-QVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNKY 229

  Fly   654 SPDEVDSLGMAYDYDSIMHYARNTFSKGTYLDTILPIEMKGRKRPEIGQRLRLSQGDIAQANLLY 718
            :...:.:.|:.|||.|:|||:...|||.... ||.|::    ....:|||..||..|:::.|.:|
  Fly   230 ARTHITNFGVEYDYQSVMHYSSRAFSKNGKA-TIEPLD----PYASLGQRRGLSDKDVSKLNEMY 289

  Fly   719 K 719
            :
  Fly   290 E 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tokNP_476879.1 ZnMc_BMP1_TLD 520..721 CDD:239808 66/209 (32%)
CUB 723..836 CDD:412131
CUB 840..951 CDD:395345
FXa_inhibition 958..993 CDD:464251
CUB 997..1111 CDD:395345
FXa_inhibition 1118..1153 CDD:464251
CUB 1158..1267 CDD:395345
CUB 1271..1390 CDD:238001
CG6696NP_573318.1 ZnMc_astacin_like 110..289 CDD:239807 62/191 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.