DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tok and Adgrg6

DIOPT Version :9

Sequence 1:NP_001287510.1 Gene:tok / 42944 FlyBaseID:FBgn0004885 Length:1464 Species:Drosophila melanogaster
Sequence 2:XP_218313.7 Gene:Adgrg6 / 308376 RGDID:1308551 Length:1248 Species:Rattus norvegicus


Alignment Length:277 Identity:71/277 - (25%)
Similarity:115/277 - (41%) Gaps:79/277 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1156 GECKYEISAPFGTIFSPNYPDSYPPNADCVWHFITTPGHRIKLIFNEFDVESHQECTYDNVAVYD 1220
            |.|:..:|.|.||..||.||:.||....|.|......|:.|::.||:||:|....|.||::::.:
  Rat    39 GNCRLVLSNPSGTFTSPCYPNDYPNTQSCSWTLRAPTGYIIQITFNDFDIEEAPNCIYDSLSLDN 103

  Fly  1221 GESESSSVLGRFCGDKIP-FPISSTSNQMYMVLKTDKNKQKNGFTASHSTACGGYLR-------- 1276
            |||::     :|||.... ...:|:.|:|::...:|.:.||.||.||       |:|        
  Rat   104 GESQT-----KFCGATAKGLSFNSSVNEMHVSFSSDFSIQKKGFNAS-------YIRVAVSLRNQ 156

  Fly  1277 -------------------ATSQVQQF---YSHARFGNQDYDDGMDCEWT-IAAPDNSYVQLIFL 1318
                               :..:::.|   :..::.||:|.|      || .:..|.|..||:  
  Rat   157 KVILPQTLDAYQVSVAKSISIPELKAFTLCFEASKVGNEDDD------WTAFSYSDKSLTQLL-- 213

  Fly  1319 TFDIESSENCTFDYVQVFSDIDDVYGQYGPMYGQYC--GNVLP----QDI--NSMTHSLLVRFKT 1375
              .:|.:.|                |.:..:.|..|  .|.||    :||  .:.....||...:
  Rat   214 --SLEKANN----------------GYFLSISGARCLLNNALPVKEKEDIFTGNFEQLCLVWNNS 260

  Fly  1376 DGSVPMKGFSASYVAVP 1392
            .|||.: .|..:|..:|
  Rat   261 WGSVGI-NFKKNYETIP 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tokNP_001287510.1 ZnMc_BMP1_TLD 520..721 CDD:239808
Astacin 527..721 CDD:279708
CUB 723..836 CDD:294042
CUB 840..951 CDD:278839
FXa_inhibition 958..993 CDD:291342
CUB 997..1111 CDD:278839
FXa_inhibition 1118..1153 CDD:291342
CUB 1158..1267 CDD:278839 38/109 (35%)
CUB 1271..1390 CDD:238001 30/157 (19%)
Adgrg6XP_218313.7 CUB 38..146 CDD:238001 40/118 (34%)
LamG 178..337 CDD:304605 29/126 (23%)
GPS 799..844 CDD:280071
7tm_4 861..1108 CDD:304433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.