DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tok and Astl

DIOPT Version :9

Sequence 1:NP_001287510.1 Gene:tok / 42944 FlyBaseID:FBgn0004885 Length:1464 Species:Drosophila melanogaster
Sequence 2:NP_001099974.1 Gene:Astl / 296129 RGDID:1562279 Length:436 Species:Rattus norvegicus


Alignment Length:308 Identity:101/308 - (32%)
Similarity:143/308 - (46%) Gaps:65/308 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   482 PPGFNQ--SQQAQQQSVPEMD--LLKAETSKDEEPLRHRVAR-------AVTAKKERIWDYGV-- 533
            |.||..  |:.:|.:.:|.::  |:..||.:....:...:.|       :||..|   |..||  
  Rat    39 PEGFTPEGSRVSQDKDIPAINQGLISEETPESSFLVEGDIIRPSPFRLLSVTNNK---WPKGVDG 100

  Fly   534 ---IPYEIDGNFSGIHKALFKLAMRHWENSTCIKFV----ERDPEIHPNYIVFTVRSCGCCSFVG 591
               ||:.:...:....:.:...|...:|..|||:||    :||       .|..:...||.|.||
  Rat   101 IVEIPFLLSSKYDEPSRQVIMEAFAEFERFTCIRFVAYRGQRD-------FVSILPMAGCFSGVG 158

  Fly   592 KRGNGPQAISIGRNC--DKFGIVVHELGHVVGFWHEHTRPDREKHVVIEHNNIMKGQDYNF---- 650
            :.| |.|.:|:...|  ...|||:|||.||:||||||:|.||::::.:..|.|:.|.:.||    
  Rat   159 RSG-GMQVVSLAPTCLQKGRGIVLHELMHVLGFWHEHSRADRDRYIRVNWNEILPGFEINFIKSR 222

  Fly   651 --NMLSPDEVDSLGMAYDYDSIMHYARNTFS-KGTYLDTILPIEMKGRKRPEIGQRLRLSQGDIA 712
              |||:|         |||.|:|||.|..|| :|.  .||:|:   ......||||..||..||.
  Rat   223 NSNMLAP---------YDYSSVMHYGRFAFSWRGQ--PTIIPL---WTSSVHIGQRWNLSTSDIT 273

  Fly   713 QANLLYKCPKC-----GRTFQ-ESSGIFASP---SHY--TAGALSNET 749
            :...||.|...     ||.|: .|.|...:|   ||.  ...|||.|:
  Rat   274 RVCRLYSCSPSVPDSHGRGFEAPSDGRSPTPASISHLQRLLEALSEES 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tokNP_001287510.1 ZnMc_BMP1_TLD 520..721 CDD:239808 78/218 (36%)
Astacin 527..721 CDD:279708 75/211 (36%)
CUB 723..836 CDD:294042 12/38 (32%)
CUB 840..951 CDD:278839
FXa_inhibition 958..993 CDD:291342
CUB 997..1111 CDD:278839
FXa_inhibition 1118..1153 CDD:291342
CUB 1158..1267 CDD:278839
CUB 1271..1390 CDD:238001
AstlNP_001099974.1 Astacin 92..283 CDD:279708 77/215 (36%)
ZnMc 99..281 CDD:294052 72/203 (35%)
ImpA_N <305..420 CDD:303075 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.