DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tok and Tnfaip6

DIOPT Version :9

Sequence 1:NP_001287510.1 Gene:tok / 42944 FlyBaseID:FBgn0004885 Length:1464 Species:Drosophila melanogaster
Sequence 2:NP_033424.1 Gene:Tnfaip6 / 21930 MGIID:1195266 Length:275 Species:Mus musculus


Alignment Length:125 Identity:44/125 - (35%)
Similarity:64/125 - (51%) Gaps:8/125 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly  1267 HSTACGGYLRATSQVQQFYSHARFGNQDYDDGMDCEWTIAAPDNSYVQLIFLTFDIESSENCTFD 1331
            |:..|||..   :..::.:....|.| :|||...|.|.|.......:.|.||.||:|....|..|
Mouse   131 HAKECGGVF---TDPKRIFKSPGFPN-EYDDNQVCYWHIRLKYGQRIHLSFLDFDLEHDPGCLAD 191

  Fly  1332 YVQVFSDIDDVYGQYGPMYGQYCGNVLPQDINSMTHSLLVRFKTDGSVPMKGFSASYVAV 1391
            ||:::...|||:|    ..|:|||:.||:||.|..:.:.::|.:|.||...||...||.|
Mouse   192 YVEIYDSYDDVHG----FVGRYCGDELPEDIISTGNVMTLKFLSDASVTAGGFQIKYVTV 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tokNP_001287510.1 ZnMc_BMP1_TLD 520..721 CDD:239808
Astacin 527..721 CDD:279708
CUB 723..836 CDD:294042
CUB 840..951 CDD:278839
FXa_inhibition 958..993 CDD:291342
CUB 997..1111 CDD:278839
FXa_inhibition 1118..1153 CDD:291342
CUB 1158..1267 CDD:278839 44/125 (35%)
CUB 1271..1390 CDD:238001 41/118 (35%)
Tnfaip6NP_033424.1 Link_domain_TSG_6_like 36..128 CDD:239592
CUB 135..244 CDD:278839 40/116 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 253..275
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.