DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tok and nas-2

DIOPT Version :10

Sequence 1:NP_476879.1 Gene:tok / 42944 FlyBaseID:FBgn0004885 Length:1464 Species:Drosophila melanogaster
Sequence 2:NP_503678.3 Gene:nas-2 / 186345 WormBaseID:WBGene00003521 Length:272 Species:Caenorhabditis elegans


Alignment Length:210 Identity:60/210 - (28%)
Similarity:94/210 - (44%) Gaps:47/210 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   528 IWDYGVIPYEIDGNFSGIHKALFKLAMRHWENSTCIKFVERDPEIHPNYI----VFTVRSCGCCS 588
            :|....:||:|..:::...|::...||..::|.||::|..| .....:|:    .|.|..  |.|
 Worm    59 LWPNAEVPYDIATHYTSTEKSIILSAMEAFKNVTCVRFRPR-AATDKHYLQINKYFNVER--CFS 120

  Fly   589 FVGKR----------GNGPQAISIGRNC---DKFGIVVHELGHVVGFWHEHTRPDREKHVVIEHN 640
            ::|::          ||....:.:...|   :..|||:|||.|::||:|||.|.||::.:|    
 Worm   121 YIGRQSSRTLFGTPEGNVETRMRLDPACLRGNGRGIVMHELMHILGFYHEHQRDDRDRRIV---- 181

  Fly   641 NIMKGQDYNFNMLSPDEVDSLGMAYDYDSIMHYARNTFSKGTYLDTILPIEMKGRKRPEIGQRLR 705
              .....|||.:....:...:| |||.:|||||   .|..       ||.:          :|..
 Worm   182 --GSAVHYNFKIYRRAKTLYMG-AYDANSIMHY---NFQN-------LPWQ----------RRDH 223

  Fly   706 LSQGDIAQANLLYKC 720
            .|..||...|..|||
 Worm   224 FSTSDIININTFYKC 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tokNP_476879.1 ZnMc_BMP1_TLD 520..721 CDD:239808 60/210 (29%)
CUB 723..836 CDD:412131
CUB 840..951 CDD:395345
FXa_inhibition 958..993 CDD:464251
CUB 997..1111 CDD:395345
FXa_inhibition 1118..1153 CDD:464251
CUB 1158..1267 CDD:395345
CUB 1271..1390 CDD:238001
nas-2NP_503678.3 Astacin 58..240 CDD:426242 60/210 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.