Sequence 1: | NP_001287510.1 | Gene: | tok / 42944 | FlyBaseID: | FBgn0004885 | Length: | 1464 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_499768.2 | Gene: | nas-1 / 185811 | WormBaseID: | WBGene00003520 | Length: | 270 | Species: | Caenorhabditis elegans |
Alignment Length: | 205 | Identity: | 70/205 - (34%) |
---|---|---|---|
Similarity: | 105/205 - (51%) | Gaps: | 15/205 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 520 AVTAKKERIWDYGVIPYEIDGNFSGIHKALFKLAMRHWENSTCIKFVERDPEIHPNYIVFTVRSC 584
Fly 585 GCCSFVGKRGNGPQAISIGRNCDKFGIVVHELGHVVGFWHEHTRPDREKHVVIEHNNIMKGQDYN 649
Fly 650 FNMLSPDEVDSLGMAYDYDSIMHYARNTFS---KGTYLDTILPIEMKGRKRPEI-GQRLRLSQGD 710
Fly 711 IAQANLLYKC 720 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tok | NP_001287510.1 | ZnMc_BMP1_TLD | 520..721 | CDD:239808 | 70/205 (34%) |
Astacin | 527..721 | CDD:279708 | 66/198 (33%) | ||
CUB | 723..836 | CDD:294042 | |||
CUB | 840..951 | CDD:278839 | |||
FXa_inhibition | 958..993 | CDD:291342 | |||
CUB | 997..1111 | CDD:278839 | |||
FXa_inhibition | 1118..1153 | CDD:291342 | |||
CUB | 1158..1267 | CDD:278839 | |||
CUB | 1271..1390 | CDD:238001 | |||
nas-1 | NP_499768.2 | Astacin | 79..266 | CDD:279708 | 66/198 (33%) |
ZnMc_astacin_like | 82..263 | CDD:239807 | 62/190 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |