DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tok and nas-24

DIOPT Version :9

Sequence 1:NP_001287510.1 Gene:tok / 42944 FlyBaseID:FBgn0004885 Length:1464 Species:Drosophila melanogaster
Sequence 2:NP_506409.2 Gene:nas-24 / 184744 WormBaseID:WBGene00003543 Length:396 Species:Caenorhabditis elegans


Alignment Length:373 Identity:89/373 - (23%)
Similarity:149/373 - (39%) Gaps:76/373 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   519 RAVTAKKERI---WDYGVIPYEIDGNFSGIHKALFKLAMRHWENSTCIKFVERDPEIHPNYIVFT 580
            :.|..:.||:   |..|.|.|....|.:.: |...|.|:.:..|.|||||.| ||.......:||
 Worm    37 KRVKREFERLGSKWLGGTINYYYADNNNSV-KEKVKSAIAYIANHTCIKFNE-DPTHWQRLKIFT 99

  Fly   581 VRSCGCCSFVGKRGN-----GPQAISIGRNCDKFGIVVHELGHVVGFWHEHTRPDREKHVVIEHN 640
            .....|.|.:|..|.     |..::..|. |...|.:|||..|.:|.:||||||||:..:.:   
 Worm   100 SELSHCRSTIGAPGTRSGSAGELSMETGW-CANIGSIVHEFSHSLGRYHEHTRPDRDNSLKV--- 160

  Fly   641 NIMKGQDYNFNMLSPDEVDSLGMAYDYDSIMHYARNTFSKGTYLDTILPIEMKGRKRPEIGQRLR 705
               ...||.... .|..:.::...:::.|||.|..:.:..|    .:.|.:|:.:.  .:|.| |
 Worm   161 ---TSTDYEARP-RPWGMTTMYGPFEHGSIMMYHSSNYGVG----KMEPYDMEYKN--TMGSR-R 214

  Fly   706 LSQGDIAQANLLYKCPKCGRTFQESSGIFASPSHYTA--------GALSNE-TEHCEWRITATYG 761
            ::..|:.:.|..|.| .|....:..:|.:.|||..:.        |.|.|| .:...:.:.||||
 Worm   215 VTFYDMYKINQYYGC-GCSTQLECKNGGYTSPSDCSRCNCPKGFFGKLCNERRQQDSYELKATYG 278

  Fly   762 --------------------------------ERVELKLENM-NIFKSNNCETDYLEI--RDGYF 791
                                            ..:|:.:|.: |:..:..|..:.:||  |:...
 Worm   279 RWQTQTISFNYKPEPVSDGFYSTFVYITGEANSTIEITMEGLENVICTAGCTWNGVEIKSREDSR 343

  Fly   792 EKSPLIGRFCGKVD---KEVIRTESSRMLLTYVNTHRIEGFRGFKAEF 836
            ..||::   |.|.:   |:|.::..:..::...:.........||..|
 Worm   344 ITSPVM---CCKDEPLYKKVFKSLHNPTIIELYSKETAPSTATFKYRF 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tokNP_001287510.1 ZnMc_BMP1_TLD 520..721 CDD:239808 59/208 (28%)
Astacin 527..721 CDD:279708 57/201 (28%)
CUB 723..836 CDD:294042 28/159 (18%)
CUB 840..951 CDD:278839
FXa_inhibition 958..993 CDD:291342
CUB 997..1111 CDD:278839
FXa_inhibition 1118..1153 CDD:291342
CUB 1158..1267 CDD:278839
CUB 1271..1390 CDD:238001
nas-24NP_506409.2 Astacin 49..231 CDD:279708 57/199 (29%)
ZnMc 52..227 CDD:294052 54/191 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.