DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tok and nas-14

DIOPT Version :9

Sequence 1:NP_001287510.1 Gene:tok / 42944 FlyBaseID:FBgn0004885 Length:1464 Species:Drosophila melanogaster
Sequence 2:NP_502533.2 Gene:nas-14 / 184247 WormBaseID:WBGene00003533 Length:503 Species:Caenorhabditis elegans


Alignment Length:243 Identity:82/243 - (33%)
Similarity:128/243 - (52%) Gaps:20/243 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   496 VPEM---DLLKA---ETSKDEEPL----RHRVARAVTAKKERIWDYGVIPYEIDGNFSGIHKALF 550
            |||:   |:||.   :...||:.:    .|.....|| ..:::|..|.:||.::...:...:...
 Worm    83 VPEIEKSDILKRLRDDPLLDEDEIFRKPFHSALNLVT-YPDKLWPEGQVPYMLEEGMTNDQRTAI 146

  Fly   551 KLAMRHWENSTCIKFVER-DPEIHPNYIVFTVRSCGCCSFVGKRGNGPQAISIG-RNCDKFGIVV 613
            ..|...::..||::||.: |.:....|:...| :.||.|:||:.| |.|.:|:. ..|...||:.
 Worm   147 AQAFDEYKTKTCVRFVPKTDDDFDYIYVKRNV-AFGCSSYVGRAG-GNQTVSLEVDKCFSKGIIA 209

  Fly   614 HELGHVVGFWHEHTRPDREKHVVIEHNNIMKGQDYNFNMLSPDEVDSLGMAYDYDSIMHYARNTF 678
            |||.|.:||:|||:|.||:..|.|..:||..|...||.......:|||||.|||:|:|||.:..|
 Worm   210 HELMHALGFFHEHSRTDRDDFVDINEDNIRPGMMRNFEKYPRKIIDSLGMPYDYESVMHYHKLAF 274

  Fly   679 SKGTYLDTILPIEMKGRKRPEIGQRLRLSQGDIAQANLLYKCPKCGRT 726
            |:.. ..||:|.:    ...::|||.:||:.|..:.|.||:|.:..:|
 Worm   275 SRNG-KPTIIPKD----NEADVGQRYKLSEMDSKKVNKLYQCGEYSKT 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tokNP_001287510.1 ZnMc_BMP1_TLD 520..721 CDD:239808 71/202 (35%)
Astacin 527..721 CDD:279708 69/195 (35%)
CUB 723..836 CDD:294042 1/4 (25%)
CUB 840..951 CDD:278839
FXa_inhibition 958..993 CDD:291342
CUB 997..1111 CDD:278839
FXa_inhibition 1118..1153 CDD:291342
CUB 1158..1267 CDD:278839
CUB 1271..1390 CDD:238001
nas-14NP_502533.2 Astacin 123..313 CDD:279708 70/196 (36%)
ZnMc_astacin_like 128..309 CDD:239807 66/187 (35%)
ShKT 380..414 CDD:214586
ShK 468..503 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3510
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.