DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tok and clec-3

DIOPT Version :10

Sequence 1:NP_476879.1 Gene:tok / 42944 FlyBaseID:FBgn0004885 Length:1464 Species:Drosophila melanogaster
Sequence 2:NP_494426.2 Gene:clec-3 / 183396 WormBaseID:WBGene00016577 Length:409 Species:Caenorhabditis elegans


Alignment Length:164 Identity:45/164 - (27%)
Similarity:62/164 - (37%) Gaps:38/164 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1137 ICMCHNGYSMHENGH----DCK------------------------------EGECKYEISAPFG 1167
            |.|.:||.|.:..|.    ||:                              |..|...:....|
 Worm   244 IAMANNGTSEYNLGQWFGVDCEGLSSFFCK
RPAGVPCSTDQPKVTVTPVPSNESFCNSTVLMTPG 308

  Fly  1168 TIFSPNYPDSYPPNADCVWHFITTPGHRIKLIFNEFDVESHQECTYDNVAVYDGESESSSVLGRF 1232
            .|.|||||.:|..|..|.:...|...:.|.|.|..|..|.:    .|.|.||||||.:...:|.:
 Worm   309 IITSPNYPQNYDNNVYCSYKLSTLGSYNILLEFTSFSTEEN----VDLVTVYDGESTNGLKIGTY 369

  Fly  1233 CGDKIPFPISSTSNQMYMVLKTDKNKQKNGFTAS 1266
            .|.:.||.:.|..|..::...||......||:|:
 Worm   370 SGSREPFHLISKGNNFFVTFATDSRNVFKGFSAT 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tokNP_476879.1 ZnMc_BMP1_TLD 520..721 CDD:239808
CUB 723..836 CDD:412131
CUB 840..951 CDD:395345
FXa_inhibition 958..993 CDD:464251
CUB 997..1111 CDD:395345
FXa_inhibition 1118..1153 CDD:464251 6/19 (32%)
CUB 1158..1267 CDD:395345 36/109 (33%)
CUB 1271..1390 CDD:238001
clec-3NP_494426.2 CLECT 22..143 CDD:214480
CLECT 163..273 CDD:214480 8/28 (29%)
CUB 299..406 CDD:238001 36/109 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.