DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tok and nas-9

DIOPT Version :9

Sequence 1:NP_001287510.1 Gene:tok / 42944 FlyBaseID:FBgn0004885 Length:1464 Species:Drosophila melanogaster
Sequence 2:NP_741532.1 Gene:nas-9 / 178875 WormBaseID:WBGene00003528 Length:546 Species:Caenorhabditis elegans


Alignment Length:251 Identity:72/251 - (28%)
Similarity:113/251 - (45%) Gaps:32/251 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   529 WD-YGVIPYEIDGNFSGIHKALFKLAMRHWENSTCIKF-VERDPE-IHPNYI-VFTVRSCGCCSF 589
            || :..|.|.:|.:.....|...:.|:.....:|||.| ....|: .|.||: |.:...|| .|:
 Worm   313 WDIWKPIQYTLDDSLEESDKKDIRDALHEISINTCILFRYNATPKGYHLNYMKVDSTTFCG-LSY 376

  Fly   590 VGKRGNGPQAISIGRNC-DKFGIVVHELGHVVGFWHEHTRPDREKHVVIEHNNIMKGQDYNFNML 653
            || |.:....|.:...| |..|:.:||..|.:|..|:|.|.||:|::.|:.:|| ..|.|:...:
 Worm   377 VG-RTDPANPIYLSFQCGDNRGVAMHETMHALGVSHQHLRLDRDKYIKIDWSNI-DPQHYDTFAI 439

  Fly   654 SPDEV-DSLGMAYDYDSIMHYARNTFSKGTYLDTILPIEMKGRKRPEIGQRLRLSQGDIAQANLL 717
            |..:: .|.|..|.|||||||.....:|.....|::|:.......|::|||.:|::|||.....:
 Worm   440 SDAKLYTSYGTKYAYDSIMHYNAYLGAKDPNKPTMIPLVNPQENTPKLGQRAKLTRGDIRLLKKM 504

  Fly   718 YKCPKCGRTFQESSGIFASPSHYTAGALSNETEHC-EWRITATYGERVELKLENMN 772
            |..|.|                      .::..|| .|.:......:.::|..|.|
 Worm   505 Y
CRPGC----------------------DDQNVHCGTWALHGYCKMKEQMKWMNEN 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tokNP_001287510.1 ZnMc_BMP1_TLD 520..721 CDD:239808 64/197 (32%)
Astacin 527..721 CDD:279708 64/197 (32%)
CUB 723..836 CDD:294042 7/51 (14%)
CUB 840..951 CDD:278839
FXa_inhibition 958..993 CDD:291342
CUB 997..1111 CDD:278839
FXa_inhibition 1118..1153 CDD:291342
CUB 1158..1267 CDD:278839
CUB 1271..1390 CDD:238001
nas-9NP_741532.1 Astacin 311..505 CDD:279708 63/194 (32%)
ZnMc_astacin_like 316..505 CDD:239807 61/191 (32%)
ShKT 510..546 CDD:214586 7/51 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.