DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tok and nas-9

DIOPT Version :10

Sequence 1:NP_476879.1 Gene:tok / 42944 FlyBaseID:FBgn0004885 Length:1464 Species:Drosophila melanogaster
Sequence 2:NP_741532.1 Gene:nas-9 / 178875 WormBaseID:WBGene00003528 Length:546 Species:Caenorhabditis elegans


Alignment Length:251 Identity:72/251 - (28%)
Similarity:113/251 - (45%) Gaps:32/251 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   529 WD-YGVIPYEIDGNFSGIHKALFKLAMRHWENSTCIKF-VERDPE-IHPNYI-VFTVRSCGCCSF 589
            || :..|.|.:|.:.....|...:.|:.....:|||.| ....|: .|.||: |.:...|| .|:
 Worm   313 WDIWKPIQYTLDDSLEESDKKDIRDALHEISINTCILFRYNATPKGYHLNYMKVDSTTFCG-LSY 376

  Fly   590 VGKRGNGPQAISIGRNC-DKFGIVVHELGHVVGFWHEHTRPDREKHVVIEHNNIMKGQDYNFNML 653
            || |.:....|.:...| |..|:.:||..|.:|..|:|.|.||:|::.|:.:|| ..|.|:...:
 Worm   377 VG-RTDPANPIYLSFQCGDNRGVAMHETMHALGVSHQHLRLDRDKYIKIDWSNI-DPQHYDTFAI 439

  Fly   654 SPDEV-DSLGMAYDYDSIMHYARNTFSKGTYLDTILPIEMKGRKRPEIGQRLRLSQGDIAQANLL 717
            |..:: .|.|..|.|||||||.....:|.....|::|:.......|::|||.:|::|||.....:
 Worm   440 SDAKLYTSYGTKYAYDSIMHYNAYLGAKDPNKPTMIPLVNPQENTPKLGQRAKLTRGDIRLLKKM 504

  Fly   718 YKCPKCGRTFQESSGIFASPSHYTAGALSNETEHC-EWRITATYGERVELKLENMN 772
            |..|.|                      .::..|| .|.:......:.::|..|.|
 Worm   505 Y
CRPGC----------------------DDQNVHCGTWALHGYCKMKEQMKWMNEN 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tokNP_476879.1 ZnMc_BMP1_TLD 520..721 CDD:239808 64/197 (32%)
CUB 723..836 CDD:412131 7/51 (14%)
CUB 840..951 CDD:395345
FXa_inhibition 958..993 CDD:464251
CUB 997..1111 CDD:395345
FXa_inhibition 1118..1153 CDD:464251
CUB 1158..1267 CDD:395345
CUB 1271..1390 CDD:238001
nas-9NP_741532.1 Astacin 311..505 CDD:426242 63/194 (32%)
ShKT 510..546 CDD:214586 7/51 (14%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.