DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13630 and ARX1

DIOPT Version :9

Sequence 1:NP_651281.1 Gene:CG13630 / 42943 FlyBaseID:FBgn0039219 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_010386.1 Gene:ARX1 / 851678 SGDID:S000002508 Length:593 Species:Saccharomyces cerevisiae


Alignment Length:374 Identity:65/374 - (17%)
Similarity:115/374 - (30%) Gaps:141/374 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 VLDDEEIEGMRVAGRLGRECL---------DEGAKAVEVGITTDELDRLVHEAAIER--ECYPSP 170
            :|.:..:...|.||::.:..|         ...:|..:..:|..||..|.....:.|  :.|.:.
Yeast    19 ILQESVLNKYRTAGQIAQTALKYVTSLINDSYHSKTTQRQLTVPELCLLTDSFILTRLEQYYKNK 83

  Fly   171 LNYYNFPKSCCTSVNEVI---CHGIPDQR-------------------PLQDGDLCNIDVTVYHR 213
            :|...........::::.   |..|.|.:                   .|:.|||..|.:.|:..
Yeast    84 VNERGIAIPTTIDIDQISGGWCPEIDDTQNLLNWNKGKDSTFASSVTGTLRPGDLVKITLGVHID 148

  Fly   214 GFHGDLNETFFVGNVSEKHKKLVQVT--------------HEALSKAI----------------- 247
            |:..:::.|..:..|.|. |.::|.|              |.|:...:                 
Yeast   149 GYTSEVSHTMVIYPVDET-KPILQPTGPLLGGKADAVAAAHIAMETVVALLACALTPEKLPASLG 212

  Fly   248 --------EFVR---------------PGEKYRDIGNVIQKYVAPHGFSVV--RSYCG------- 280
                    :.:|               ||.:.|.    |::::|.....:|  |.|.|       
Yeast   213 GTSSGITGQLIRTIVDTIARSYNCGVVPGSRVRR----IRRFLAGQNEGIVAEREYKGVVWTESH 273

  Fly   281 ------------------HGIHRVFHTAPNVPHYAKNSAVGVMAPGHCFTIE-PMISV------G 320
                              .|....|.....:|     |...|:..|..:.|: .|.|:      |
Yeast   274 QEADLLSNTDAKDLTVVDRGQSTPFTNVSAIP-----SDDFVVQSGEVYLIDLKMASLEHCTKKG 333

  Fly   321 VQKAETWPDDWTA--------VTADGLYSAQFEQT-LLVNETGCEILTK 360
            :...|| .|.:|.        :...|.|...|.|| :|..:|..::|||
Yeast   334 LVTLET-VDSYTGKSHKAGELIARPGAYVRDFAQTHILKLKTSRQLLTK 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13630NP_651281.1 zf-C6H2 9..48 CDD:292429
PLN03158 10..369 CDD:215607 65/374 (17%)
MetAP1 123..360 CDD:238519 62/366 (17%)
ARX1NP_010386.1 APP_MetAP 25..>285 CDD:412280 40/264 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.