DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13630 and MAP1C

DIOPT Version :9

Sequence 1:NP_651281.1 Gene:CG13630 / 42943 FlyBaseID:FBgn0039219 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_172785.1 Gene:MAP1C / 837887 AraportID:AT1G13270 Length:369 Species:Arabidopsis thaliana


Alignment Length:363 Identity:139/363 - (38%)
Similarity:188/363 - (51%) Gaps:48/363 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GSFFCSQPCFKGFWKEHKAIHALAAGASNSAEQDGAYNPWPHFRF-------------------- 72
            |.:.....||.|           |...|:|....|..|.:...:|                    
plant    24 GEYLAPSRCFLG-----------APVTSSSLSLSGKKNSYSPRQFHVSAKKVSGLEEAIRIRKMR 77

  Fly    73 ----TGKLRPFPQ------TPKRTVPNAIQRPDYADHPAGRSLSEEALRGTKIKVLDDEEIEGMR 127
                ..|:|..|.      :|:..||:.|.||.|.:......:|.|      .::...|.|..||
plant    78 ELETKSKVRRNPPLRRGRVSPRLLVPDHIPRPPYVESGVLPDISSE------FQIPGPEGIAKMR 136

  Fly   128 VAGRLGRECLDEGAKAVEVGITTDELDRLVHEAAIERECYPSPLNYYNFPKSCCTSVNEVICHGI 192
            .|..|....|:.....|:..:||:|:|:.||:..||...|||||.|..||||.||||||.:||||
plant   137 AACELAARVLNYAGTLVKPSVTTNEIDKAVHDMIIEAGAYPSPLGYGGFPKSVCTSVNECMCHGI 201

  Fly   193 PDQRPLQDGDLCNIDVTVYHRGFHGDLNETFFVGNVSEKHKKLVQVTHEALSKAIEFVRPGEKYR 257
            ||.|.||.||:.|||||||..|:|||.:.|||.|.|.|..|:||:||.|.|.:.|...:.|..::
plant   202 PDSRQLQSGDIINIDVTVYLDGYHGDTSRTFFCGEVDEGFKRLVKVTEECLERGIAVCKDGASFK 266

  Fly   258 DIGNVIQKYVAPHGFSVVRSYCGHGIHRVFHTAPNVPHYAKNSAVGVMAPGHCFTIEPMISVGVQ 322
            .||..|.::....|::||..:.|||:..|||:.|.:.|| :|...|:|..|..|||||::::|..
plant   267 KIGKRISEHAEKFGYNVVERFVGHGVGPVFHSEPLIYHY-RNDEPGLMVEGQTFTIEPILTIGTT 330

  Fly   323 KAETWPDDWTAVTADGLYSAQFEQTLLVNETGCEILTK 360
            :..||||:||.:||||..:||||.|:|:..||.|||||
plant   331 ECVTWPDNWTTLTADGGVAAQFEHTILITRTGSEILTK 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13630NP_651281.1 zf-C6H2 9..48 CDD:292429 4/19 (21%)
PLN03158 10..369 CDD:215607 139/363 (38%)
MetAP1 123..360 CDD:238519 114/236 (48%)
MAP1CNP_172785.1 MetAP1 132..368 CDD:238519 114/236 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1002357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100342
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.