DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13630 and MAP1D

DIOPT Version :9

Sequence 1:NP_651281.1 Gene:CG13630 / 42943 FlyBaseID:FBgn0039219 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_568014.1 Gene:MAP1D / 829858 AraportID:AT4G37040 Length:350 Species:Arabidopsis thaliana


Alignment Length:286 Identity:142/286 - (49%)
Similarity:175/286 - (61%) Gaps:7/286 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KLRPFPQTPKRTVPNAIQRPDYADHPAGRSLSEEALRGTKIKVLDDEEIEGMRVAGRLGRECLDE 139
            :|||...:|:|.||..|.:|.|.|......:|      :.::|.|.:.||.||.:|.|.....|.
plant    71 RLRPGNVSPRRPVPGHITKPPYVDSLQAPGIS------SGLEVHDKKGIECMRASGILAARVRDY 129

  Fly   140 GAKAVEVGITTDELDRLVHEAAIERECYPSPLNYYNFPKSCCTSVNEVICHGIPDQRPLQDGDLC 204
            ....|:.|:||||:|..||...||...|||||.|..||||.||||||.|||||||.|||:|||:.
plant   130 AGTLVKPGVTTDEIDEAVHNMIIENGAYPSPLGYGGFPKSVCTSVNECICHGIPDSRPLEDGDII 194

  Fly   205 NIDVTVYHRGFHGDLNETFFVGNVSEKHKKLVQVTHEALSKAIEFVRPGEKYRDIGNVIQKYVAP 269
            |||||||..|:|||.:.|||.|||.||.||||:||.|:|.|||....||.:|:.||.||......
plant   195 NIDVTVYLNGYHGDTSATFFCGNVDEKAKKLVEVTKESLDKAISICGPGVEYKKIGKVIHDLADK 259

  Fly   270 HGFSVVRSYCGHGIHRVFHTAPNVPHYAKNSAVGVMAPGHCFTIEPMISVGVQKAETWPDDWTAV 334
            |.:.|||.:.|||:..|||..|.|.|:..|.| |.|.....||||||:::|.:....|.|:||.|
plant   260 HKYGVVRQFVGHGVGSVFHADPVVLHFRNNEA-GRMVLNQTFTIEPMLTIGSRNPIMWDDNWTVV 323

  Fly   335 TADGLYSAQFEQTLLVNETGCEILTK 360
            |.|...|||||.|:|:.:.|.|||||
plant   324 TEDASLSAQFEHTILITKDGAEILTK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13630NP_651281.1 zf-C6H2 9..48 CDD:292429
PLN03158 10..369 CDD:215607 142/286 (50%)
MetAP1 123..360 CDD:238519 126/236 (53%)
MAP1DNP_568014.1 MetAP1 113..349 CDD:238519 126/236 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1002357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100342
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.