DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13630 and MAP1B

DIOPT Version :9

Sequence 1:NP_651281.1 Gene:CG13630 / 42943 FlyBaseID:FBgn0039219 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_189202.1 Gene:MAP1B / 822165 AraportID:AT3G25740 Length:344 Species:Arabidopsis thaliana


Alignment Length:279 Identity:119/279 - (42%)
Similarity:169/279 - (60%) Gaps:8/279 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 TPKRTVPNAIQRPDYADHPAGRSLSEEALRGTKIKVLDDEEIEGMRVAGRLGRECLDEGAKAVEV 146
            :|:.:||:.|.:|.|.:......:|.|      :::.|...|..|:.|..|....||.....|..
plant    70 SPRLSVPDHILKPLYVESSKVPEISSE------LQIPDSIGIVKMKKACELAARVLDYAGTLVRP 128

  Fly   147 GITTDELDRLVHEAAIERECYPSPLNYYNFPKSCCTSVNEVICHGIPDQRPLQDGDLCNIDVTVY 211
            .:||||:|:.||:..||...|||||.|..||||.||||||.:.|||||.||||:||:.||||.||
plant   129 FVTTDEIDKAVHQMVIEFGAYPSPLGYGGFPKSVCTSVNECMFHGIPDSRPLQNGDIINIDVAVY 193

  Fly   212 HRGFHGDLNETFFVGNVSEKHKKLVQVTHEALSKAIEFVRPGEKYRDIGNVIQKYVAPHGFSVVR 276
            ..|:|||.::||..|:|:...|:||:||.|.|.|.|...:.|..::.||.:|.::.|.:|:::.|
plant   194 LDGYHGDTSKTFLCGDVNGSLKQLVKVTEECLEKGISVCKDGASFKQIGKIISEHAAKYGYNMER 258

  Fly   277 SYCGHGIHRVFHTAPNV-PHYAKNSAVGVMAPGHCFTIEPMISVGVQKAETWPDDWTAVTADGLY 340
             :.|||:..|.|:.|.: .|...:..:..|..|..||:||::::|..:..||||.||.|||||..
plant   259 -FIGHGVGTVLHSEPLIYLHSNYDYELEYMIEGQTFTLEPILTIGTTEFVTWPDKWTIVTADGGP 322

  Fly   341 SAQFEQTLLVNETGCEILT 359
            :||||.|:|:..||.||||
plant   323 AAQFEHTILITTTGAEILT 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13630NP_651281.1 zf-C6H2 9..48 CDD:292429
PLN03158 10..369 CDD:215607 119/279 (43%)
MetAP1 123..360 CDD:238519 110/238 (46%)
MAP1BNP_189202.1 MetAP1 105..341 CDD:238519 108/236 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1002357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100342
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.