DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13630 and Metap1d

DIOPT Version :9

Sequence 1:NP_651281.1 Gene:CG13630 / 42943 FlyBaseID:FBgn0039219 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_011238040.1 Gene:Metap1d / 66559 MGIID:1913809 Length:420 Species:Mus musculus


Alignment Length:394 Identity:133/394 - (33%)
Similarity:177/394 - (44%) Gaps:110/394 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 FWKEHKAIHALAAGASNSAEQDGAYNPWPHFRFTGKLRPFPQTPKRTVPNAIQRPDYA------D 98
            ||::....|::.:.|:.|                         |...||..|::|||.      |
Mouse    59 FWRQRDISHSVVSPAAVS-------------------------PAHPVPKRIKKPDYVTTGIVPD 98

  Fly    99 HPAGRSLSEEALRGTKIKVLDDEEIEGMRVAGRLGRECLDEGAKAVEVGITTDELDRLVHEAAIE 163
            .            |..|:|.|:::|:|:|.|.||.|..|....|:::|.:||:|:|.|||...|.
Mouse    99 W------------GDSIEVKDEDQIQGLREACRLARHVLLLAGKSLKVDMTTEEIDALVHWEIIR 151

  Fly   164 RECYPSPLNYYNFPKSCCTSVNEVICHGIPDQRPLQDGDLCNIDVTVYHRGFHGDLNETFFVGNV 228
            .:.|||||.|..||||.|||||.|:||||||.|||||||:.|||||||:.|:|||.:|||.||||
Mouse   152 HDAYPSPLGYGRFPKSVCTSVNNVLCHGIPDSRPLQDGDIINIDVTVYYNGYHGDTSETFLVGNV 216

  Fly   229 SEKHKKLVQVTHEALSKAIEFVRPGEKYRDIGNVIQ---KYVAPHG----FSVVRSYCG------ 280
            .|..||||:|......:||...|.|..:..|||.|:   ..:.||.    |:.:.::||      
Mouse   217 DESGKKLVEVARRCRDEAIAACRAGAPFSVIGNTIRCRLVTLKPHNSSEWFASLSTFCGTWDRII 281

  Fly   281 -----HGIHRVF-----------------------------------HTAPNVPHYAKNSAVG-- 303
                 ..:...|                                   :..|..|.......||  
Mouse   282 LSWTPRNLASCFLPRLHLDLGRPGEVASGGTGNSRCEEKELPVSEDSNCPPAWPWQTAQEWVGSE 346

  Fly   304 ------------VMAPGHCFTIEPMISVGVQKAETWPDDWTAVTADGLYSAQFEQTLLVNETGCE 356
                        .|..|..|||||:|:.|..:.:...|.||.|:.|...|||||.|:|:...|.|
Mouse   347 NTDTTKANDNDLPMEEGMAFTIEPIITEGSPEFKVLEDAWTVVSLDNQRSAQFEHTVLITPRGVE 411

  Fly   357 ILTK 360
            ||||
Mouse   412 ILTK 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13630NP_651281.1 zf-C6H2 9..48 CDD:292429 2/7 (29%)
PLN03158 10..369 CDD:215607 133/394 (34%)
MetAP1 123..360 CDD:238519 114/303 (38%)
Metap1dXP_011238040.1 MetAP1 111..415 CDD:238519 114/303 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100342
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.