DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13630 and Metap2

DIOPT Version :9

Sequence 1:NP_651281.1 Gene:CG13630 / 42943 FlyBaseID:FBgn0039219 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_062622.1 Gene:Metap2 / 56307 MGIID:1929701 Length:478 Species:Mus musculus


Alignment Length:418 Identity:85/418 - (20%)
Similarity:138/418 - (33%) Gaps:150/418 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 EQDGAYNPWPHFRFTGKLR--------PFPQTPKRTVP-------NAIQRPDYADHP-------- 100
            :.|||         |||.:        |..||...:||       ....:....::|        
Mouse    91 DADGA---------TGKKKKKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPTQDGRTA 146

  Fly   101 AGRSLSEEALRGTKIKVLD--DEEI-EGMRVAGRLGRECLDEGAKAVEVGITTDELDRLVHEAA- 161
            |.|:.|||.      |.||  .||| ...|.|....|:........::.|:|..|:...:.:.: 
Mouse   147 AWRTTSEEK------KALDQASEEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLEDCSR 205

  Fly   162 -IERECYPSPLNYYN----FPKSCCTSVNEVICHGIP---DQRPLQDGDLCNIDVTVYHRGFH-- 216
             :.:|      |..|    ||..|  |:|....|..|   |...||..|:|.||.     |.|  
Mouse   206 KLIKE------NGLNAGLAFPTGC--SLNNCAAHYTPNAGDTTVLQYDDICKIDF-----GTHIS 257

  Fly   217 GDLNETFFVGNVSEKHKKLVQVTHEALSKAIEFVRPGEKYRDIGNVIQKYVAPHGFSV------- 274
            |.:.:..|....:.|:..|:....:|.:..|:......:..|:|..||:.:..:...:       
Mouse   258 GRIIDCAFTVTFNPKYDILLTAVKDATNTGIKCAGIDVRLCDVGEAIQEVMESYEVEIDGKTYQV 322

  Fly   275 --VRSYCGHGI--HRVFHTAPNVP------------------------------------HYAKN 299
              :|:..||.|  :|: |....||                                    ||.||
Mouse   323 KPIRNLNGHSIGPYRI-HAGKTVPIVKGGEATRMEEGEVYAIETFGSTGKGVVHDDMECSHYMKN 386

  Fly   300 SAVG---VMAP-----------------------------GHCFTIEPMISVGVQKAETWPDDWT 332
            ..||   :..|                             .:...::.:..:|:  .:.:|   .
Mouse   387 FDVGHVPIRLPRTKHLLNVINENFGTLAFCRRWLDRLGESKYLMALKNLCDLGI--VDPYP---P 446

  Fly   333 AVTADGLYSAQFEQTLLVNETGCEILTK 360
            .....|.|:||||.|:|:..|..|::::
Mouse   447 LCDIKGSYTAQFEHTILLRPTCKEVVSR 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13630NP_651281.1 zf-C6H2 9..48 CDD:292429
PLN03158 10..369 CDD:215607 85/418 (20%)
MetAP1 123..360 CDD:238519 63/327 (19%)
Metap2NP_062622.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..123 11/40 (28%)
PTZ00053 <107..478 CDD:240246 79/393 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.