DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13630 and Dip-C

DIOPT Version :9

Sequence 1:NP_651281.1 Gene:CG13630 / 42943 FlyBaseID:FBgn0039219 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001287306.1 Gene:Dip-C / 47769 FlyBaseID:FBgn0000455 Length:491 Species:Drosophila melanogaster


Alignment Length:320 Identity:69/320 - (21%)
Similarity:119/320 - (37%) Gaps:67/320 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 IQRPDYA---DHPAGRSLSEEALRGTKIKVLDDEEIEGMRVAGRLGRECLDEGAKAVEVGITTDE 152
            :|.||:|   .:....:|....|...:: :...||||.:|...::..:...:..:.:..|....|
  Fly   161 LQPPDFAGKEKYVTDCNLLYPILSECRV-IKSPEEIEVLRYVAKVSSDAHIKVMRFMRPGRMEFE 224

  Fly   153 LDRL-VHEAAIERECYPSPLNYYNFPKSCCTSVNEVICH----GIPDQRPLQDGDLCNIDVTVYH 212
            .:.| :|.|.....|     .:.::...|.:..|..|.|    |.|:.:|:||||||..|:...:
  Fly   225 GESLFLHHAYSVGGC-----RHASYTCICGSGTNSSILHYGHAGAPNSKPVQDGDLCLFDMGANY 284

  Fly   213 RGFHGDLNETFFV-GNVSEKHKKLVQVTHEALSKAIEFVRPGEKYRDI----------------- 259
            .|:..|:..||.. |..::..|.:.....:|.:...|..|.|..:.|:                 
  Fly   285 CGYAADITCTFPANGKFTDDQKFIYNAVLDARNAVTESARDGVSWVDMHKLAGRVLLQRLKEGGM 349

  Fly   260 --GNVIQKYVA-------PHGFSVVRSYCGHGIHRVFHTA----------PNVPHYAKNSAVGVM 305
              |:|.:...|       |||.       ||.|....|..          |:.|..:|.....::
  Fly   350 LKGDVEEMLEAGVSGVFQPHGL-------GHLIGLDVHDVGGYLPKEPKRPSEPWLSKLRFARIL 407

  Fly   306 APGHCFTIEP---MISVGVQKAETWPDDWTAVTAD------GLYSAQFEQTLLVNETGCE 356
            ..|...||||   .|:..:.:|...|:....:.|:      .....:.|..:|:.:||.|
  Fly   408 KAGMYVTIEPGCYFINWLMDRALADPNIAKFINAEMFNRFRNFGGVRIEDDVLITKTGVE 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13630NP_651281.1 zf-C6H2 9..48 CDD:292429
PLN03158 10..369 CDD:215607 69/320 (22%)
MetAP1 123..360 CDD:238519 61/285 (21%)
Dip-CNP_001287306.1 AMP_N 12..158 CDD:198079
PRK10879 57..483 CDD:182804 69/320 (22%)
Prolidase 195..468 CDD:238520 61/285 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456485
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.