DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13630 and CG10576

DIOPT Version :9

Sequence 1:NP_651281.1 Gene:CG13630 / 42943 FlyBaseID:FBgn0039219 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001286949.1 Gene:CG10576 / 38645 FlyBaseID:FBgn0035630 Length:391 Species:Drosophila melanogaster


Alignment Length:99 Identity:24/99 - (24%)
Similarity:43/99 - (43%) Gaps:11/99 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 FPKSCCTSVNEVICHGIPDQR----PLQDGDLCNIDVTVYHRGFHGDLNETFFVG-----NVSEK 231
            ||  .|.|||..:||..|.:.    .|:.||:..||:..:..||......|..||     .:|.:
  Fly    76 FP--TCLSVNNCVCHFSPAKNDADYTLKAGDVVKIDLGAHIDGFIAVAAHTIVVGAAADQKISGR 138

  Fly   232 HKKLVQVTHEALSKAIEFVRPGEKYRDIGNVIQK 265
            ...::...:.|:..|:..::.|.....:.:.:|:
  Fly   139 QADVILAAYWAVQAALRLLKSGANNYSLTDAVQQ 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13630NP_651281.1 zf-C6H2 9..48 CDD:292429
PLN03158 10..369 CDD:215607 24/99 (24%)
MetAP1 123..360 CDD:238519 24/99 (24%)
CG10576NP_001286949.1 APP_MetAP 3..361 CDD:294199 24/99 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456482
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.