DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13630 and pa2g4a

DIOPT Version :9

Sequence 1:NP_651281.1 Gene:CG13630 / 42943 FlyBaseID:FBgn0039219 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001002070.1 Gene:pa2g4a / 368737 ZFINID:ZDB-GENE-030616-161 Length:392 Species:Danio rerio


Alignment Length:107 Identity:31/107 - (28%)
Similarity:47/107 - (43%) Gaps:15/107 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 FPKSCCTSVNEVICH-----GIPDQRPLQDGDLCNIDVTVYHRGFHGDLNETFFVGNVSE----- 230
            ||  .|.|||..:||     ..||.. |:||||..||:.|:..||..::..:|.:|...|     
Zfish    75 FP--TCVSVNNCVCHFSPLKSDPDYM-LKDGDLVKIDLGVHVDGFISNVAHSFVIGATKEAPVTG 136

  Fly   231 KHKKLVQVTHEALSKAIEFVRPGEKYRDIGNVIQKYVAPHGF 272
            :...:::..|.....|:..|:||.:...:.....|..  |.|
Zfish   137 RKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIA--HSF 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13630NP_651281.1 zf-C6H2 9..48 CDD:292429
PLN03158 10..369 CDD:215607 31/107 (29%)
MetAP1 123..360 CDD:238519 31/107 (29%)
pa2g4aNP_001002070.1 crvDNA_42K 2..381 CDD:273105 31/107 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.