DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13630 and und

DIOPT Version :9

Sequence 1:NP_651281.1 Gene:CG13630 / 42943 FlyBaseID:FBgn0039219 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001260299.1 Gene:und / 34294 FlyBaseID:FBgn0283478 Length:448 Species:Drosophila melanogaster


Alignment Length:400 Identity:83/400 - (20%)
Similarity:132/400 - (33%) Gaps:154/400 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 QTPKRTVPNAIQRPD-------YADHPAGRSLSEEALRGTKIKVLDDEEIEGMRVAGRLGRECLD 138
            ||...|:|.|...||       ..:||..:.:.::  |..|.:...:|:    |...|:..:...
  Fly    79 QTDPPTIPIAKLYPDGNFPEGEIVEHPTPKDMPDD--RTAKDRFTSEEK----RALDRINTDIYQ 137

  Fly   139 EGAKAVEV--------------GIT----TDELD----RLVHEAAIERECYPSPLNYYNFPKSCC 181
            |..:|.|.              |:|    .:||:    ||:.|..:|..        ..||..| 
  Fly   138 ELRQAAEAHRQTRQYMQRYIKPGMTMIQICEELENTARRLIGENGLEAG--------LAFPTGC- 193

  Fly   182 TSVNEVICHGIP---DQRPLQDGDLCNIDVTVYHRGFH--GDLNETFFVGNVSEKHKKLVQVTHE 241
             |:|....|..|   |...||..|:|.||.     |.|  |.:.:..|....:.|:.||:|...|
  Fly   194 -SLNHCAAHYTPNAGDPTVLQYDDVCKIDF-----GTHIKGRIIDCAFTLTFNNKYDKLLQAVKE 252

  Fly   242 ALSKAIEFVRPGEKYRDIGNVIQKYVAPHGFSV---------VRSYCGHGI--HRVFHTAPNVP- 294
            |.:..|.......:..|||..||:.:..:...:         :|:..||.|  :|: |....|| 
  Fly   253 ATNTGIREAGIDVRLCDIGAAIQEVMESYEIELDGKTYPIKAIRNLNGHSISPYRI-HAGKTVPI 316

  Fly   295 -----------------------------------HYAKNSAVGVMAPGHCFTIEPMISVGVQKA 324
                                               ||.||           |.: |.:.:.:|.:
  Fly   317 VKGGESTRMEEDEFYAIETFGSTGRGLVHDDMDCSHYMKN-----------FDL-PFVPLRLQSS 369

  Fly   325 -----------------ETWPD---------------DWTAVTA-------DGLYSAQFEQTLLV 350
                             :.|.|               |...|.|       .|.|:||:|.|:::
  Fly   370 KQLLGTINKNFGTLAFCKRWLDRAGATKYQMALKDLCDKGIVEAYPPLCDIKGCYTAQYEHTIML 434

  Fly   351 NETGCEILTK 360
            ..|..|::::
  Fly   435 RPTCKEVVSR 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13630NP_651281.1 zf-C6H2 9..48 CDD:292429
PLN03158 10..369 CDD:215607 83/399 (21%)
MetAP1 123..360 CDD:238519 71/349 (20%)
undNP_001260299.1 PTZ00053 <79..448 CDD:240246 83/399 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456479
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.