DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13630 and pa2g4b

DIOPT Version :9

Sequence 1:NP_651281.1 Gene:CG13630 / 42943 FlyBaseID:FBgn0039219 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_997806.1 Gene:pa2g4b / 323462 ZFINID:ZDB-GENE-030131-2182 Length:394 Species:Danio rerio


Alignment Length:187 Identity:41/187 - (21%)
Similarity:68/187 - (36%) Gaps:65/187 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 FPKSCCTSVNEVICHGIPDQRP----LQDGDLCNIDVTVYHRGFHGDLNETFFVG-----NVSEK 231
            ||  .|.|||..:||..|.:..    |:||||..||:.|:..||..::..:|.||     .|:.:
Zfish    76 FP--TCVSVNNCVCHFSPIKSDPDYMLKDGDLVKIDLGVHVDGFISNVAHSFVVGATKDAPVTGR 138

  Fly   232 HKKLVQVTHEALSKAIEFVRPGEKYRDIGNVIQKYVAPHGFSVVRSYCGHGIHRVFHTAPNVPHY 296
            ...:::..|.....|:..|:||.:...:.....|        :.:|:                  
Zfish   139 KADVIKAAHLCAEAALRLVKPGNQNSQVTEAWNK--------IAQSF------------------ 177

  Fly   297 AKNSAVGVMAPGHCFTIEPMISVGVQKAETWPDDWTAVTADGLYSAQFEQTLLVNET 353
                        .|..||.|:|..:::.          ..||      |:|::.|.|
Zfish   178 ------------KCMPIEGMLSHQLKQH----------VIDG------EKTIIQNPT 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13630NP_651281.1 zf-C6H2 9..48 CDD:292429
PLN03158 10..369 CDD:215607 41/187 (22%)
MetAP1 123..360 CDD:238519 41/187 (22%)
pa2g4bNP_997806.1 crvDNA_42K 1..387 CDD:273105 41/187 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.