DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13630 and Metap1d

DIOPT Version :9

Sequence 1:NP_651281.1 Gene:CG13630 / 42943 FlyBaseID:FBgn0039219 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001101282.2 Gene:Metap1d / 311748 RGDID:1307413 Length:334 Species:Rattus norvegicus


Alignment Length:327 Identity:133/327 - (40%)
Similarity:177/327 - (54%) Gaps:44/327 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 FWKEHKAIHALAAGASNSAEQDGAYNPWPHFRFTGKLRPFPQTPKRTVPNAIQRPDYA------D 98
            ||::....|::.:.|:.|                         |...||..|::|||.      |
  Rat    41 FWRQRDISHSVVSPAAVS-------------------------PAHPVPEHIKKPDYVTTGIVPD 80

  Fly    99 HPAGRSLSEEALRGTKIKVLDDEEIEGMRVAGRLGRECLDEGAKAVEVGITTDELDRLVHEAAIE 163
            .            |..|:|.::::|:|:|.|.||.|..|....|:::||:||:|:|.|||...|.
  Rat    81 W------------GDSIEVKNEDQIQGLREACRLARHVLLLAGKSLKVGMTTEEIDALVHREIIR 133

  Fly   164 RECYPSPLNYYNFPKSCCTSVNEVICHGIPDQRPLQDGDLCNIDVTVYHRGFHGDLNETFFVGNV 228
            |:.|||||.|..||||.|||||.|:||||||.|||||||:.|||||||:.|:|||.:|||.||||
  Rat   134 RDAYPSPLGYGRFPKSVCTSVNNVLCHGIPDSRPLQDGDIINIDVTVYYNGYHGDTSETFLVGNV 198

  Fly   229 SEKHKKLVQVTHEALSKAIEFVRPGEKYRDIGNVIQKYVAPHGFSVVRSYCGHGIHRVFHTAPNV 293
            .|...|||:|......:||...|.|..:..|||.|......:|..|...:.||||...||..|.:
  Rat   199 DESGTKLVEVARACRDEAIAACRAGAPFSVIGNTISHITRQNGLQVCPHFVGHGIGSYFHGHPEI 263

  Fly   294 PHYAKNSAVGVMAPGHCFTIEPMISVGVQKAETWPDDWTAVTADGLYSAQFEQTLLVNETGCEIL 358
            .|:|.::.: .|.....|||||:|:.|..:.:...|.||.|:.|...|||||.|:|:...|.|||
  Rat   264 WHHANDNDL-PMEERMAFTIEPIITEGSPEFKVLEDAWTVVSLDNRRSAQFEHTVLITPRGVEIL 327

  Fly   359 TK 360
            ||
  Rat   328 TK 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13630NP_651281.1 zf-C6H2 9..48 CDD:292429 2/7 (29%)
PLN03158 10..369 CDD:215607 133/327 (41%)
MetAP1 123..360 CDD:238519 115/236 (49%)
Metap1dNP_001101282.2 MetAP1 93..329 CDD:238519 115/236 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1002357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100342
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.