DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13630 and Pa2g4

DIOPT Version :9

Sequence 1:NP_651281.1 Gene:CG13630 / 42943 FlyBaseID:FBgn0039219 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001004206.1 Gene:Pa2g4 / 288778 RGDID:1302994 Length:394 Species:Rattus norvegicus


Alignment Length:190 Identity:48/190 - (25%)
Similarity:82/190 - (43%) Gaps:30/190 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 DHPAGRSLSEEALRGTKIKVLDDEEIEGMRVAGRLGRECLDEGAKAVEVGITTDELDRLVHEAA- 161
            |....::::|: |..||.|:       |..:|.|:.|..::..:..|.|....::.|.::.|.. 
  Rat     5 DEQQEQTIAED-LVVTKYKM-------GGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETG 61

  Fly   162 ----IERECYPSPLNYYNFPKSCCTSVNEVICHGIP---DQ-RPLQDGDLCNIDVTVYHRGFHGD 218
                .|:|....    ..||.|  .|||..:||..|   || ..|::|||..||:.|:..||..:
  Rat    62 KIFKKEKEMKKG----IAFPTS--ISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIAN 120

  Fly   219 LNETFFVG-----NVSEKHKKLVQVTHEALSKAIEFVRPGEKYRDIGNVIQKYVAPHGFS 273
            :..||.:|     .|:.:...:::..|.....|:..|:||.:...:.....|  ..|.|:
  Rat   121 VAHTFVIGVAQGSQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNK--VAHSFN 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13630NP_651281.1 zf-C6H2 9..48 CDD:292429
PLN03158 10..369 CDD:215607 48/190 (25%)
MetAP1 123..360 CDD:238519 42/165 (25%)
Pa2g4NP_001004206.1 crvDNA_42K 1..388 CDD:273105 48/190 (25%)
Necessary for nucleolar localization. /evidence=ECO:0000250|UniProtKB:Q9UQ80 2..48 12/50 (24%)
RNA-binding. /evidence=ECO:0000250|UniProtKB:Q9UQ80 46..54 0/7 (0%)
Necessary for nucleolar localization. /evidence=ECO:0000250|UniProtKB:Q9UQ80 301..394
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 358..394
Interaction with RNA. /evidence=ECO:0000250|UniProtKB:P50580 361..375
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.