DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13630 and METAP1D

DIOPT Version :9

Sequence 1:NP_651281.1 Gene:CG13630 / 42943 FlyBaseID:FBgn0039219 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_016859239.1 Gene:METAP1D / 254042 HGNCID:32583 Length:358 Species:Homo sapiens


Alignment Length:279 Identity:122/279 - (43%)
Similarity:158/279 - (56%) Gaps:26/279 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 VPNAIQRPDYA------DHPAGRSLSEEALRGTKIKVLDDEEIEGMRVAGRLGRECLDEGAKAVE 145
            ||..|::|||.      |.            |..|:|.::::|:|:..|.:|.|..|....|:::
Human    80 VPKHIKKPDYVTTGIVPDW------------GDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLK 132

  Fly   146 VGITTDELDRLVHEAAIERECYPSPLNYYNFPKSCCTSVNEVICHGIPDQRPLQDGDLCNIDVTV 210
            |.:||:|:|.|||...|....|||||.|..||||.|||||.|:||||||.|||||||:.||||||
Human   133 VDMTTEEIDALVHREIISHNAYPSPLGYGGFPKSVCTSVNNVLCHGIPDSRPLQDGDIINIDVTV 197

  Fly   211 YHRGFHGDLNETFFVGNVSEKHKKLVQVTHEALSKAIEFVRPGEKYRDIGNVIQKYVAPHGFSVV 275
            |:.|:|||.:|||.||||.|..||||:|......:||...|.|..:..|||.|......:||.|.
Human   198 YYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISHITHQNGFQVC 262

  Fly   276 RSYCGHGIHRVFHTAPNVPHYAKNSAVGVMAPGHCFTIEPMISVGVQKAETWPDDWTAVTADG-- 338
            ..:.||||...||..|.:.|:|.:|.: .|..|..|||||:|:.|..:.:...|.||.|:.|.  
Human   263 PHFVGHGIGSYFHGHPEIWHHANDSDL-PMEEGMAFTIEPIITEGSPEFKVLEDAWTVVSLDNQR 326

  Fly   339 -LYSAQFEQTLLVNETGCE 356
             |.||    .||:|..|.|
Human   327 CLLSA----LLLLNCMGKE 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13630NP_651281.1 zf-C6H2 9..48 CDD:292429
PLN03158 10..369 CDD:215607 122/279 (44%)
MetAP1 123..360 CDD:238519 112/237 (47%)
METAP1DXP_016859239.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1002357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100342
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.