DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13630 and metap1d

DIOPT Version :9

Sequence 1:NP_651281.1 Gene:CG13630 / 42943 FlyBaseID:FBgn0039219 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_017953030.2 Gene:metap1d / 100496112 XenbaseID:XB-GENE-960806 Length:352 Species:Xenopus tropicalis


Alignment Length:309 Identity:130/309 - (42%)
Similarity:173/309 - (55%) Gaps:30/309 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 EQDGAYN-PWPHFRFTGKLRPFPQTPKRTVPNAIQRPDYA------DHPAGRSLSEEALRGTKIK 116
            ::..||| .||     |.:     :|...||..|.:|||.      |.            |..|:
 Frog    62 QRSSAYNIVWP-----GTV-----SPAHPVPKHIMKPDYVTTGIVPDW------------GDYIE 104

  Fly   117 VLDDEEIEGMRVAGRLGRECLDEGAKAVEVGITTDELDRLVHEAAIERECYPSPLNYYNFPKSCC 181
            :.|:::|:|:|.|.:|.|..|....|:::||:||:|:|.||||..|....|||||.|..||||.|
 Frog   105 IKDEDQIQGLRQACQLARHILLMAGKSLKVGMTTEEIDALVHENIISCNAYPSPLGYGGFPKSVC 169

  Fly   182 TSVNEVICHGIPDQRPLQDGDLCNIDVTVYHRGFHGDLNETFFVGNVSEKHKKLVQVTHEALSKA 246
            ||||.|:||||||.|.|||||:.|||||||..|:|||.:|||.||||.:..:.||::......:|
 Frog   170 TSVNNVVCHGIPDSRALQDGDIINIDVTVYFGGYHGDTSETFLVGNVDKCGRALVEIARRCRDEA 234

  Fly   247 IEFVRPGEKYRDIGNVIQKYVAPHGFSVVRSYCGHGIHRVFHTAPNVPHYAKNSAVGVMAPGHCF 311
            |...:||..:..|||.|.:....:|..|..|:.||||...||..|.:.|:|.::.. .|..|..|
 Frog   235 IAVCKPGAPFSAIGNTISRIARENGLQVCPSFVGHGIGSFFHGHPEIWHHANDNDF-PMEEGMAF 298

  Fly   312 TIEPMISVGVQKAETWPDDWTAVTADGLYSAQFEQTLLVNETGCEILTK 360
            ||||:|..|..:.:...|.||||:.|...|||.|.|:.:...|.|||||
 Frog   299 TIEPIIMEGSPEFKILKDKWTAVSVDNKRSAQCEHTIAITSGGAEILTK 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13630NP_651281.1 zf-C6H2 9..48 CDD:292429
PLN03158 10..369 CDD:215607 130/309 (42%)
MetAP1 123..360 CDD:238519 111/236 (47%)
metap1dXP_017953030.2 MetAP1 111..347 CDD:238519 111/236 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1002357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.