DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb10 and RPB10

DIOPT Version :9

Sequence 1:NP_651280.1 Gene:Rpb10 / 42942 FlyBaseID:FBgn0039218 Length:67 Species:Drosophila melanogaster
Sequence 2:NP_014853.3 Gene:RPB10 / 854385 SGDID:S000005736 Length:70 Species:Saccharomyces cerevisiae


Alignment Length:68 Identity:50/68 - (73%)
Similarity:56/68 - (82%) Gaps:1/68 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIIPIRCFTCGKVIGNKWESYLGLLQA-EYTEGDALDALGLKRYCCRRMLLGHVDLIEKLLNYAP 64
            ||:|:|||:||||:|:||||||.|||. |..||.||..|||||||||||:|.|||||||.|.|.|
Yeast     1 MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP 65

  Fly    65 LEK 67
            |||
Yeast    66 LEK 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb10NP_651280.1 PLN00032 1..67 CDD:215034 48/66 (73%)
RPB10NP_014853.3 RNA_pol_N 1..70 CDD:412528 50/68 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346844
Domainoid 1 1.000 96 1.000 Domainoid score I1643
eggNOG 1 0.900 - - E1_COG1644
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H129854
Inparanoid 1 1.050 108 1.000 Inparanoid score I1400
Isobase 1 0.950 - 0 Normalized mean entropy S44
OMA 1 1.010 - - QHG62157
OrthoFinder 1 1.000 - - FOG0003540
OrthoInspector 1 1.000 - - oto99159
orthoMCL 1 0.900 - - OOG6_101548
Panther 1 1.100 - - LDO PTHR23431
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1179
SonicParanoid 1 1.000 - - X2037
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.