DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb10 and NRPB10

DIOPT Version :9

Sequence 1:NP_651280.1 Gene:Rpb10 / 42942 FlyBaseID:FBgn0039218 Length:67 Species:Drosophila melanogaster
Sequence 2:NP_849640.1 Gene:NRPB10 / 837690 AraportID:AT1G11475 Length:71 Species:Arabidopsis thaliana


Alignment Length:67 Identity:55/67 - (82%)
Similarity:59/67 - (88%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIIPIRCFTCGKVIGNKWESYLGLLQAEYTEGDALDALGLKRYCCRRMLLGHVDLIEKLLNYAPL 65
            ||||:|||||||||||||:.||.|||.:||||||||||.|.||||||||:.|||||||||||..|
plant     1 MIIPVRCFTCGKVIGNKWDQYLDLLQLDYTEGDALDALQLVRYCCRRMLMTHVDLIEKLLNYNTL 65

  Fly    66 EK 67
            ||
plant    66 EK 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb10NP_651280.1 PLN00032 1..67 CDD:215034 53/65 (82%)
NRPB10NP_849640.1 PLN00032 1..71 CDD:215034 55/67 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 111 1.000 Domainoid score I2082
eggNOG 1 0.900 - - E1_COG1644
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H129854
Inparanoid 1 1.050 121 1.000 Inparanoid score I1979
OMA 1 1.010 - - QHG62157
OrthoDB 1 1.010 - - D1639063at2759
OrthoFinder 1 1.000 - - FOG0003540
OrthoInspector 1 1.000 - - otm2652
orthoMCL 1 0.900 - - OOG6_101548
Panther 1 1.100 - - O PTHR23431
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2037
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.