DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb10 and polr2l.1

DIOPT Version :9

Sequence 1:NP_651280.1 Gene:Rpb10 / 42942 FlyBaseID:FBgn0039218 Length:67 Species:Drosophila melanogaster
Sequence 2:NP_001016343.1 Gene:polr2l.1 / 549097 XenbaseID:XB-GENE-1003788 Length:67 Species:Xenopus tropicalis


Alignment Length:67 Identity:62/67 - (92%)
Similarity:66/67 - (98%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIIPIRCFTCGKVIGNKWESYLGLLQAEYTEGDALDALGLKRYCCRRMLLGHVDLIEKLLNYAPL 65
            ||||:|||||||::|||||:||||||||||||||||||||||||||||||.||||||||||||||
 Frog     1 MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPL 65

  Fly    66 EK 67
            ||
 Frog    66 EK 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb10NP_651280.1 PLN00032 1..67 CDD:215034 60/65 (92%)
polr2l.1NP_001016343.1 RNA_pol_N 1..59 CDD:395951 52/57 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 123 1.000 Domainoid score I5507
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H129854
Inparanoid 1 1.050 139 1.000 Inparanoid score I4399
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1639063at2759
OrthoFinder 1 1.000 - - FOG0003540
OrthoInspector 1 1.000 - - otm47759
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1179
SonicParanoid 1 1.000 - - X2037
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.