powered by:
Protein Alignment Rpb10 and polr2l.1
DIOPT Version :9
Sequence 1: | NP_651280.1 |
Gene: | Rpb10 / 42942 |
FlyBaseID: | FBgn0039218 |
Length: | 67 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001016343.1 |
Gene: | polr2l.1 / 549097 |
XenbaseID: | XB-GENE-1003788 |
Length: | 67 |
Species: | Xenopus tropicalis |
Alignment Length: | 67 |
Identity: | 62/67 - (92%) |
Similarity: | 66/67 - (98%) |
Gaps: | 0/67 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MIIPIRCFTCGKVIGNKWESYLGLLQAEYTEGDALDALGLKRYCCRRMLLGHVDLIEKLLNYAPL 65
||||:|||||||::|||||:||||||||||||||||||||||||||||||.||||||||||||||
Frog 1 MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPL 65
Fly 66 EK 67
||
Frog 66 EK 67
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
123 |
1.000 |
Domainoid score |
I5507 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
1 |
1.000 |
- |
- |
|
H129854 |
Inparanoid |
1 |
1.050 |
139 |
1.000 |
Inparanoid score |
I4399 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1639063at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003540 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm47759 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1179 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X2037 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
8 | 8.090 |
|
Return to query results.
Submit another query.