DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb10 and POLR2L

DIOPT Version :9

Sequence 1:NP_651280.1 Gene:Rpb10 / 42942 FlyBaseID:FBgn0039218 Length:67 Species:Drosophila melanogaster
Sequence 2:NP_066951.1 Gene:POLR2L / 5441 HGNCID:9199 Length:67 Species:Homo sapiens


Alignment Length:67 Identity:62/67 - (92%)
Similarity:66/67 - (98%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIIPIRCFTCGKVIGNKWESYLGLLQAEYTEGDALDALGLKRYCCRRMLLGHVDLIEKLLNYAPL 65
            ||||:|||||||::|||||:||||||||||||||||||||||||||||||.||||||||||||||
Human     1 MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPL 65

  Fly    66 EK 67
            ||
Human    66 EK 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb10NP_651280.1 PLN00032 1..67 CDD:215034 60/65 (92%)
POLR2LNP_066951.1 RNA_pol_N 1..59 CDD:395951 52/57 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160534
Domainoid 1 1.000 123 1.000 Domainoid score I5610
eggNOG 1 0.900 - - E1_COG1644
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H129854
Inparanoid 1 1.050 139 1.000 Inparanoid score I4514
Isobase 1 0.950 - 0 Normalized mean entropy S44
OMA 1 1.010 - - QHG62157
OrthoDB 1 1.010 - - D1639063at2759
OrthoFinder 1 1.000 - - FOG0003540
OrthoInspector 1 1.000 - - oto88816
orthoMCL 1 0.900 - - OOG6_101548
Panther 1 1.100 - - LDO PTHR23431
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1179
SonicParanoid 1 1.000 - - X2037
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.