powered by:
Protein Alignment Rpb10 and Polr2l
DIOPT Version :9
Sequence 1: | NP_651280.1 |
Gene: | Rpb10 / 42942 |
FlyBaseID: | FBgn0039218 |
Length: | 67 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001137383.1 |
Gene: | Polr2l / 502374 |
RGDID: | 1566209 |
Length: | 67 |
Species: | Rattus norvegicus |
Alignment Length: | 67 |
Identity: | 62/67 - (92%) |
Similarity: | 66/67 - (98%) |
Gaps: | 0/67 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MIIPIRCFTCGKVIGNKWESYLGLLQAEYTEGDALDALGLKRYCCRRMLLGHVDLIEKLLNYAPL 65
||||:|||||||::|||||:||||||||||||||||||||||||||||||.||||||||||||||
Rat 1 MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPL 65
Fly 66 EK 67
||
Rat 66 EK 67
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1639063at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.