DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb10 and rpb10

DIOPT Version :9

Sequence 1:NP_651280.1 Gene:Rpb10 / 42942 FlyBaseID:FBgn0039218 Length:67 Species:Drosophila melanogaster
Sequence 2:NP_594797.1 Gene:rpb10 / 2542233 PomBaseID:SPAC1B3.12c Length:71 Species:Schizosaccharomyces pombe


Alignment Length:67 Identity:51/67 - (76%)
Similarity:59/67 - (88%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIIPIRCFTCGKVIGNKWESYLGLLQAEYTEGDALDALGLKRYCCRRMLLGHVDLIEKLLNYAPL 65
            ||||||||:||||||:||::||.|||.:.|||:|||.|||:|||||||:|.|||||||||.|.||
pombe     1 MIIPIRCFSCGKVIGDKWDTYLTLLQEDNTEGEALDKLGLQRYCCRRMILTHVDLIEKLLCYNPL 65

  Fly    66 EK 67
            .|
pombe    66 SK 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb10NP_651280.1 PLN00032 1..67 CDD:215034 50/65 (77%)
rpb10NP_594797.1 PLN00032 1..70 CDD:215034 51/67 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 103 1.000 Domainoid score I1747
eggNOG 1 0.900 - - E1_COG1644
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H129854
Inparanoid 1 1.050 111 1.000 Inparanoid score I1571
OMA 1 1.010 - - QHG62157
OrthoFinder 1 1.000 - - FOG0003540
OrthoInspector 1 1.000 - - oto100690
orthoMCL 1 0.900 - - OOG6_101548
Panther 1 1.100 - - LDO PTHR23431
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1179
SonicParanoid 1 1.000 - - X2037
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.