DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slo and LOC101884790

DIOPT Version :9

Sequence 1:NP_001262924.1 Gene:slo / 42940 FlyBaseID:FBgn0003429 Length:1217 Species:Drosophila melanogaster
Sequence 2:XP_005173069.3 Gene:LOC101884790 / 101884790 -ID:- Length:175 Species:Danio rerio


Alignment Length:184 Identity:128/184 - (69%)
Similarity:146/184 - (79%) Gaps:13/184 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly  1003 MITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLIT 1067
            ||||||||||||||||||||||||||||||||||||||||||||||||.||||.|.|||||:|:|
Zfish     1 MITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVT 65

  Fly  1068 GGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQISLYDGPLAQFGECGKYGDLFVAALKSY 1132
            ||||||||.:|||...|||||||.::|:|||||||.|::|||||.|..|:.|.|||||..|||:|
Zfish    66 GGATPELEGLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADLGDGGCYGDLFCKALKTY 130

  Fly  1133 GMLCIGLYRFRD----TSSSCDASSKRYVITNPPDDFSLLPTDQVFVLMQFDPG 1182
            .|||.|:||.||    .:|.|   :|||||||||  :.||.|    :::|.:.|
Zfish   131 NMLCFGIYRLRDAHLTAASLC---TKRYVITNPP--YELLCT----LILQSEHG 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sloNP_001262924.1 Ion_trans 110..321 CDD:395416
BK_channel_a 470..566 CDD:397526
LOC101884790XP_005173069.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D124461at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.