DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAP3K10 and BCK1

DIOPT Version :9

Sequence 1:XP_011525283.1 Gene:MAP3K10 / 4294 HGNCID:6849 Length:962 Species:Homo sapiens
Sequence 2:NP_012440.1 Gene:BCK1 / 853350 SGDID:S000003631 Length:1478 Species:Saccharomyces cerevisiae


Alignment Length:330 Identity:88/330 - (26%)
Similarity:153/330 - (46%) Gaps:53/330 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   102 EIIGVGGFGKVYRAL--WRGEEVAVKAARLD--PEKDPAV--TAEQVCQEARLFGALQHPNIIAL 160
            |:||.|.||.||..|  ..||.:|||...:.  ..::.|:  |.|.:..|......|.|.||:..
Yeast  1179 EMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLNIVQY 1243

Human   161 RGACLNPPHLCLVMEYARGGALSRVLA--GRRVPPHVLVNWAVQVARGMNYLHNDAPVPIIHRDL 223
            .|.........|.:||..||::..::.  ||...| ::.:...||.:|:.|||:..   |:|||:
Yeast  1244 LGFENKNNIYSLFLEYVAGGSVGSLIRMYGRFDEP-LIKHLTTQVLKGLAYLHSKG---ILHRDM 1304

Human   224 KSINILILEAIENHNLADTVLKITDFGLAR---EWHKTTKMSAAGTYAWMAPEVIRLSL-FSKSS 284
            |:.|:|:.:        |.:.||:|||::|   :.:..:.|:..||..|||||::.... :|...
Yeast  1305 KADNLLLDQ--------DGICKISDFGISRKSKDIYSNSDMTMRGTVFWMAPEMVDTKQGYSAKV 1361

Human   285 DVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIP-STCPEPFARLLEGEPGPRD--EE 346
            |:||.|.::.|:..|:.|:..::.:|..:.:..:|...||| .|.|      |..:.| |:  :.
Yeast  1362 DIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLP------LISQIG-RNFLDA 1419

Human   347 CWDPDPHGRPDFGSILKRLEVIEQSALFQMPLESFHSLQEDWKLEIQHMFDDLRTKEK----ELR 407
            |::.:|..||....:|.               ..|..:.|.:..:...:...:::.:|    :||
Yeast  1420 CFEINPEKRPTANELLS---------------HPFSEVNETFNFKSTRLAKFIKSNDKLNSSKLR 1469

Human   408 SREEE 412
            ...:|
Yeast  1470 ITSQE 1474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAP3K10XP_011525283.1 SH3_MLK1-3 20..76 CDD:212992
TyrKc 98..365 CDD:197581 82/277 (30%)
PKc_like 103..368 CDD:304357 81/279 (29%)
BCK1NP_012440.1 STKc_Bck1_like 1173..1440 CDD:270799 82/294 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.