DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppox and CG6034

DIOPT Version :9

Sequence 1:NP_651278.2 Gene:Ppox / 42939 FlyBaseID:FBgn0020018 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_649005.1 Gene:CG6034 / 39974 FlyBaseID:FBgn0036750 Length:479 Species:Drosophila melanogaster


Alignment Length:467 Identity:99/467 - (21%)
Similarity:159/467 - (34%) Gaps:155/467 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLGGGLSGLSAGYYLLRRFGKPLTIYEASPRVGGWVRSENRKDRNFIFESGPRTIRPVGEPGANT 69
            ::|.|.||::|...||.:..|.:.::||..|:||  |.......|.:.:.|.:...  ||.|...
  Fly    21 IIGAGASGVAAATKLLEQGFKNVLLFEAEDRIGG--RINTILFANSLIDLGAQWCH--GEEGNVV 81

  Fly    70 LELVEDLKL------EVTPIRRSH----VAARNRMLYAKGQLCMLPNSPKGLFGVLPPFTKPLYK 124
            .|.|:||.:      .|....||:    ....|:.|........:|...:|..|           
  Fly    82 YEKVKDLDVLDRTGDYVVHFIRSNKEILTDVHNKALTELTNAFEVPGEHEGSVG----------- 135

  Fly   125 AVLRDLFTASKKAKLEDESIYSFA--ERRFGKEIADYAISPMICGICAGD-AREISVR----FLM 182
                |.|.|..|     |:|:...  ::...||..| .:..:||.:.|.| ..|:|.|    |.:
  Fly   136 ----DAFNAYWK-----ENIHQLVPNDKTIAKEAQD-CLKKVICSMDACDNLSELSYRNFRNFAI 190

  Fly   183 EG----LFEKEQKYGGVLKGTLISRFEKNKTKDTKDGLFAERQPKLYAQAVKEKWAMYGLKGGLE 243
            .|    |..:::.|...|...|.|               ::.||           ...|:..|..
  Fly   191 AGGDQNLSWRQKGYWKFLSVLLNS---------------SDNQP-----------GDQGILKGHV 229

  Fly   244 NLPKTMRKYLGERDVNVQLSNECRNLTFSSSGVRMNIKDAEVPVEHVVSSLPAYKLAPLVKQQH- 307
            :|.|.:.|...|.|  .:|:..|.|..|             |..:||:.::   .|..|.::.| 
  Fly   230 HLNKRIAKINWEGD--GELTLRCWNGQF-------------VSADHVICTV---SLGVLREKHHK 276

  Fly   308 ---PSLSA-QLLSIPYVDVLVVNMQFPGKLLKQDGFGLLVPPVEKLPLLGVIFDSCCFDMGENTV 368
               |:|.| ::.||.                     ||.:..|.|                    
  Fly   277 LFVPALPASKIRSIE---------------------GLKLGTVNK-------------------- 300

  Fly   369 LTVMMGGHWFDQWFGDRPSPKQILDLATSHVQKMLQIREEPK---------FSRVHTLHKCIPQY 424
                     |...|.::|.|:.|.::|...:::.|:.....|         |.||....:.:..:
  Fly   301 ---------FYLEFEEQPVPENIREMAFLWLEEDLKELRSGKYFWLESVCYFHRVDCQPRLLQGW 356

  Fly   425 TVG-HKRRVEAI 435
            .:| |.|.||.|
  Fly   357 IIGAHSRYVETI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpoxNP_651278.2 HemY 17..472 CDD:224153 94/455 (21%)
NAD_binding_8 18..76 CDD:290186 16/57 (28%)
CG6034NP_649005.1 Amino_oxidase 33..470 CDD:279874 94/455 (21%)
NAD_binding_8 <35..88 CDD:290186 16/56 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452783
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.