DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puf and Usp18

DIOPT Version :9

Sequence 1:NP_001262923.1 Gene:puf / 42935 FlyBaseID:FBgn0039214 Length:3930 Species:Drosophila melanogaster
Sequence 2:NP_001014080.1 Gene:Usp18 / 312688 RGDID:1359153 Length:362 Species:Rattus norvegicus


Alignment Length:384 Identity:89/384 - (23%)
Similarity:138/384 - (35%) Gaps:80/384 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  2003 WPRDEGRAECGYVGLTNLGATCYMASCVQHLYMMPQARAAVLR--VPPNAARKHGPTLLELQRMF 2065
            |.|..     |:|||.|:|.||.:.|.:|...|....|..:.|  ||..|..:......:|..:.
  Rat    45 WDRPH-----GFVGLHNIGQTCCLNSLIQVFMMNVDFRMVLKRITVPRGAEEQKRSVPFQLLLLL 104

  Fly  2066 AYLLESERKSYNPRSFCRVYQMDHQPLNTGEQKDMAEFFIDLVSKLEDMTP--DLKHLVKRLFCG 2128
            ..:.:|.:|:..|....:..|..:.||..  |.|.|..|:.:.:..:|...  ||...::.||..
  Rat   105 EKMQDSRQKAVLPTELVQCLQKYNVPLFV--QHDAAHLFLTIWNLTKDQITDIDLAERLQDLFTI 167

  Fly  2129 SLSNNVVSLDCGHVSRTAEDFYTVRCQVADM-----RNLQESLDEVTVKDTLEGDNMYTCSQCGK 2188
            ....:::.:.||..|.......|:...:.||     :.|:::|........|...:...|..|||
  Rat   168 WTEESLMCVGCGAESSRRGKLLTLSLPLFDMDSKPLKTLEDALRCFFQPKELASSDKCFCETCGK 232

  Fly  2189 KVRAEKRACFKKLPQILCFNTMRYTFNMVTMLKEKVNTHFSFPLRLNMCHYVEKTLMPQQYKEER 2253
            |...::.......||.|..:.||::......:|              :||.|   ..||..    
  Rat   233 KTPCKQAQKLTGFPQTLTIHLMRFSVRNSQTVK--------------ICHSV---YFPQSL---- 276

  Fly  2254 ERRQKEKEGADGSGDGNDNEKAEATLDDDIEECYEYELVGVTVHTGTADGGHYYSFIKERTKTSY 2318
                             |..:...|.|   :....|||..|..|.|.||.|||.::|:.      
  Rat   277 -----------------DFSQILPTTD---QSEIHYELFAVIAHVGMADFGHYCAYIRN------ 315

  Fly  2319 HTHERWFLFNDAEVKPFDPSQIAAECFGGEMTSKTYDSVTEKYLDFSFEKTNSAYMLFY 2377
            .....||.|||:.|           |:      .|:..|...|.|..:....:||:|.|
  Rat   316 PVDGEWFCFNDSHV-----------CW------VTWKDVQCTYGDHIYRWRETAYLLVY 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pufNP_001262923.1 peptidase_C19C 2013..2382 CDD:239124 87/374 (23%)
UCH 2014..2377 CDD:278850 85/371 (23%)
DUF3517 2723..>2877 CDD:288853
Usp18NP_001014080.1 UCH 52..357 CDD:278850 85/370 (23%)
Peptidase_C19 53..358 CDD:239072 85/371 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5077
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.