DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atl and AT1G03830

DIOPT Version :9

Sequence 1:NP_001287506.1 Gene:atl / 42934 FlyBaseID:FBgn0039213 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_001184903.1 Gene:AT1G03830 / 839398 AraportID:AT1G03830 Length:1013 Species:Arabidopsis thaliana


Alignment Length:444 Identity:88/444 - (19%)
Similarity:150/444 - (33%) Gaps:131/444 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GSAVQVINASEEHTFVLNEDALSEVLMRDEVKDRFVCVVSVAGAFRKGKSFLLDFFLRYMYSKYV 67
            |.|||::...|......:.:|:..:   .::|.. |.|||:.|...:||||:.:..|        
plant     9 GRAVQLVYVDENGKLKTDPEAIGAL---QKLKGP-VAVVSLFGKALQGKSFIWNQLL-------- 61

  Fly    68 HHDATDWLGGESD----PLEGFSWRGGSERDTTGILMWSDIFLHDYPNGDKIAIILLDTQGAFDS 128
                :..:|.|..    |..|..|            ||.:.......:|.:.:::|||.:.....
plant    62 ----SRSIGFEVQTLHRPCNGDIW------------MWIEPVKRISEDGTEYSLVLLDVELEDAK 110

  Fly   129 QSTVRDCATVFALSTMLSSVQIYNLSQNIQEDDLQHLQLFTEYGRLALADTGKKPFQRLQFLVRD 193
            .......:.:|:|:.:||||.||..:..:.:..|.                              
plant   111 SIPATHNSQIFSLAILLSSVFIYGPTLGLNDIALD------------------------------ 145

  Fly   194 WSFPYEAEYGALGGDKILKRRLEVSDKQHPELQSLRRHISSCFTEVACFLMPHPGLNVATNPKFD 258
                             |.|.||:..:.|     :.....:.|.|:..|           :|.|.
plant   146 -----------------LSRLLEIRKQDH-----VGEAKDNTFFELGQF-----------SPMFV 177

  Fly   259 GRLQDITPEF---------KSSLRSLVPMLLAPDNLVYKEISGQRVRARD----------LIQYF 304
            ..:.||..|.         .|.|:.|.|:||...:.:.|.:| :|||.:.          |..:.
plant   178 QLMMDINSETVEGGEDVTQNSKLKKLRPLLLYGVDALMKFVS-ERVRPKQRGDTIVTGPPLAGFT 241

  Fly   305 QSYMNIYKGNELPEPKSMLVATAEANHLTAVAAAKELYGQLMEEVCGGTRPYLSTAHLQTEHLRV 369
            :::......|.:|:..|:.....|.....|...|.|:|...:|.   ...|  ..:.|...|.:.
plant   242 KAFSENVNNNIVPKISSLWQTVEELEGRRARDTATEVYMSSLER---SETP--DESMLLEAHNKA 301

  Fly   370 KDKALFQFAAKRKMGGEEFTEK--------FRKQLEDDLEEVFTNYQAHNESKN 415
            ..:||..| .:..:|..|..:|        |.|.|||  .:...|.:|::...|
plant   302 VVEALTAF-CESSIGNVEVKQKYKRDLWSFFAKALED--HKRVANVEAYSRCCN 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atlNP_001287506.1 GBP 14..289 CDD:280433 51/287 (18%)
MSC <316..>471 CDD:286487 25/108 (23%)
AT1G03830NP_001184903.1 GBP 34..270 CDD:206650 60/324 (19%)
GBP_C 228..463 CDD:308475 27/133 (20%)
Smc <527..867 CDD:224117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2037
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027269at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.