DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atl and Gbp3

DIOPT Version :9

Sequence 1:NP_001287506.1 Gene:atl / 42934 FlyBaseID:FBgn0039213 Length:541 Species:Drosophila melanogaster
Sequence 2:XP_038959795.1 Gene:Gbp3 / 685116 RGDID:1597766 Length:1255 Species:Rattus norvegicus


Alignment Length:415 Identity:98/415 - (23%)
Similarity:172/415 - (41%) Gaps:85/415 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VCVVSVAGAFRKGKSFLLDFFLRYMYSKYVHHDATDWLGGESDPLEGFSWRGGSERDTTGILMWS 102
            |.||::.|.:|.|||:|:                 :.|.|:::   ||........:|.||.|| 
  Rat   671 VVVVAIVGMYRTGKSYLM-----------------NCLAGQNN---GFPLGCTVXSETKGIWMW- 714

  Fly   103 DIFLHDYPNGDKIAIILLDTQGAFD-SQSTVRDCATVFALSTMLSSVQIYNLSQNIQEDDLQHLQ 166
               ...:|......:|||||:|..| .:...|:.|.:|||:.:|||..:||....|..|.|:.|.
  Rat   715 ---CVPHPTKPSHTLILLDTEGLGDVEKGDARNDAWIFALAVLLSSTFVYNSMSTINNDALEKLH 776

  Fly   167 LFTEYGRLALADTGKKP------------FQRLQFLVRDWSFPYEAEYGALGGDKILKRRLEVSD 219
            ..|:...|..|.:..:.            |....:.|||::...:.:...:..|:.|:..|::..
  Rat   777 YVTKLTELIRAKSSPRSDGIEDAREFVGFFPDFIWTVRDFTLELKLDGHCITEDQYLENALQLVP 841

  Fly   220 KQHPELQSL---RRHISSCFTEVACFLMPHPGLNVATNPKFDGRLQDIT-----PEFKSSLRSLV 276
            .|.|:.|:.   |..|...|....||:...|    .::|:...:::.|:     |.|:..|.:..
  Rat   842 GQDPQTQTSNWPRECIRQFFPRRKCFVFDWP----VSDPQLLAKIESISESQLNPNFQKQLENFC 902

  Fly   277 PMLLAPDNLVYKEISGQRV---------RARDLIQYFQSYMNIYKGNELPEPKSMLVATAEANHL 332
                   :.::...:|:|:         |..:|:   |:|::......:|..::.:...||..:.
  Rat   903 -------SYIFSHATGKRL
GEGILVTGSRLGNLV---QTYVDAINTGTVPCLENAVKTLAERENS 957

  Fly   333 TAVAAAKELYGQLMEEVCGGTRPYLSTAHLQ---TEHLRVKDKALFQFAAKRKMGGEEFTE---K 391
            |||..|.|.|.:.|.:     |..|.|..||   :.|...:.:|:..|..      ..|.:   |
  Rat   958 TAVQKAAEHYSEQMAQ-----RVRLPTDTLQELLSVHSACEKEAIAVFME------HSFKDDQWK 1011

  Fly   392 FRKQLEDDLEEVFTNYQAHNESKNI 416
            |:|:|...:||....:...|||.::
  Rat  1012 FQKKLVVTIEERKKVFMEQNESASL 1036

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atlNP_001287506.1 GBP 14..289 CDD:280433 64/271 (24%)
MSC <316..>471 CDD:286487 28/107 (26%)
Gbp3XP_038959795.1 GBP 18..280 CDD:308078
GBP_C 282..578 CDD:397124
GBP 651..914 CDD:308078 65/277 (23%)
GBP_C 916..1209 CDD:397124 32/135 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335784
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027269at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.