DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atl and Gbp10

DIOPT Version :9

Sequence 1:NP_001287506.1 Gene:atl / 42934 FlyBaseID:FBgn0039213 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_001034735.2 Gene:Gbp10 / 626578 MGIID:4359647 Length:611 Species:Mus musculus


Alignment Length:471 Identity:107/471 - (22%)
Similarity:178/471 - (37%) Gaps:99/471 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EEHT--FVLNEDALSEVLMRDEVKDRF---VCVVSVAGAFRKGKSFLLDFFLRYMYSKYVHHDAT 72
            |.|.  ..:|::|:       |:.|:.   |.||::.|..|.|||:|:                 
Mouse    13 ENHNEQLSVNQEAI-------EILDKISQPVVVVAIVGWSRTGKSYLM----------------- 53

  Fly    73 DWLGGESDPLEGFSWRGGSERDTTGILMWSDIFLHDYPNGDKIAIILLDTQGAFD-SQSTVRDCA 136
            :.|.|::   .||......:..|.||.||    ...:|...:..::||||:|..| .:...::..
Mouse    54 NCLAGQN---HGFPLGSTVQSQTKGIWMW----CMPHPTKPEHTLVLLDTEGLGDVEKGDPKNDL 111

  Fly   137 TVFALSTMLSSVQIYNLSQNIQEDDLQHLQLFTEYGRLALADTGKKP------------FQRLQF 189
            .:||||.:|||..|||....|....|:.|...||...|..|.:...|            |....:
Mouse   112 WIFALSVLLSSTFIYNSMITINHQALEQLHYVTELTELIRAKSSPNPAGIKNSTEFVSFFPDFVW 176

  Fly   190 LVRDWSFPYEAEYGALGGDKILKRRLEVSDKQHPELQ---SLRRHISSCFTEVACFLMPHP---- 247
            :|||:....:.....:..|..|:..|::.....|.:|   |.|..|...|....||:...|    
Mouse   177 IVRDFMLELKLNGEDITSDDYLENALKLIPGDKPRMQASNSCRECIRLFFPNRKCFVFDRPTHDK 241

  Fly   248 ----GLNVATNPKFDGRLQDITPEFKSSLRSLVPMLLAPDNLVYKEI----SGQRVRARDLIQYF 304
                .|:..|..:.|.:.|::|..|.|.:            ..|.:|    .|.:|....|....
Mouse   242 ELLQKLDSITEDQLDPKFQEVTKAFVSYI------------FTYAKIKTLKEGIKVTGNKLGILV 294

  Fly   305 QSYMNIYKGNELPEPKSMLVATAEANHLTAVAAAKELYGQLMEEVCGGTRPYLSTAHLQ---TEH 366
            .:|::......:|.....:...|:..:..||..|.:.|.:.|.:     |..|.|..||   ..|
Mouse   295 TTYVDAINSGAVPCLDDAVTTLAQRENSVAVQKAADHYSEQMAQ-----RLRLPTETLQELLDVH 354

  Fly   367 LRVKDKALFQFAAKR-KMGGEEFTEKFRKQLEDDLEEVF--TNYQAHNE---------SKNIFKA 419
            ...:.:|:..|.... |...::|.:|. .:|..:.:|:|  .|.:|.|:         ||:..:.
Mouse   355 AACEKEAMAVFMEHSFKDENQQFLKKL-VELIGENKELFLSKNEEASNKYCQEELDRLSKDFMEN 418

  Fly   420 ARTPAVYFACAVIMYI 435
            ..|  .:..|...:|:
Mouse   419 IST--FFVPCGHKLYM 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atlNP_001287506.1 GBP 14..289 CDD:280433 72/303 (24%)
MSC <316..>471 CDD:286487 29/135 (21%)
Gbp10NP_001034735.2 GBP 16..279 CDD:280433 72/305 (24%)
GBP_C 281..575 CDD:202427 33/160 (21%)
GBP_C 287..575 CDD:293879 31/154 (20%)
coiled coil 544..555 CDD:293879
coiled coil 564..575 CDD:293879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832126
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027269at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.