DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atl and GBP7

DIOPT Version :9

Sequence 1:NP_001287506.1 Gene:atl / 42934 FlyBaseID:FBgn0039213 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_997281.2 Gene:GBP7 / 388646 HGNCID:29606 Length:638 Species:Homo sapiens


Alignment Length:443 Identity:99/443 - (22%)
Similarity:179/443 - (40%) Gaps:86/443 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ASEEHT-------------FVLNEDALSEVLMRDEVKDRFVCVVSVAGAFRKGKSFLLDFFLRYM 62
            |||.|.             .|:|.:|| |:|   ....:.|.||::.|.:|.|||:|:       
Human     2 ASEIHMPGPVCLTENTKGHLVVNSEAL-EIL---SAITQPVVVVAIVGLYRTGKSYLM------- 55

  Fly    63 YSKYVHHDATDWLGGESDPLEGFSWRGGSERDTTGILMWSDIFLHDYPNGDKIAIILLDTQGAFD 127
                      :.|.|::   :||......:.:|.||.||    ...:|:.....:|||||:|..|
Human    56 ----------NKLAGKN---KGFPLGCTVKSETKGIWMW----CVPHPSKPNHTLILLDTEGLGD 103

  Fly   128 -SQSTVRDCATVFALSTMLSSVQIYNLSQNIQEDDLQHLQLFTEYGRLALADTGKKP-------- 183
             .:|..:..:.:|||:.:|||..:||....|....|:.|...||...|..|.:..:|        
Human   104 MEKSDPKSDSWIFALAVLLSSSFVYNSMGTINHQALEQLHYVTELTELIRAKSCPRPDEVEDSSE 168

  Fly   184 ----FQRLQFLVRDWSFPYEAEYGALGGDKILKRRLEVSDKQHPELQSL---RRHISSCFTEVAC 241
                |....:.|||::...:.:...:..|:.|:..|::...::|::|:.   |..|...|.:..|
Human   169 FVSFFPDFIWTVRDFTLELKLDGHPITEDEYLENALKLISGKNPQIQNSNKPREWIRHFFPKQKC 233

  Fly   242 FLMPHP--------GLNVATNPKFDGRLQDITPEFKSSLRSLVPMLLAPDNLVYKEISGQRVRAR 298
            |:...|        .:......:.|...|..:..|.|.:.:........:.::   ::|.|    
Human   234 FVFDRPINDKKLLLHVEEVREDQLDSNFQMQSENFCSYIFTHAKTKTLREGIL---VTGNR---- 291

  Fly   299 DLIQYFQSYMNIYKGNELPEPKSMLVATAEANHLTAVAAAKELYGQLMEEVC---GGTRPYLSTA 360
             |....::|::.......|..::.:...|:..:..||..|...|.|.|.:..   ..|...|...
Human   292 -LGMLVETYLDAINSGATPCLENAMAVLAQCENSAAVQRAANHYSQQMAQQVRFPTDTLQELLDV 355

  Fly   361 HLQTEHLRVKDKALF-QFAAKRKMGGEEFTEKFRKQLEDDLEEVFTNYQAHNE 412
            |...|...:   |:| :::.|.|      :::|:|:|.|.:|:...::...||
Human   356 HAVCEREAI---AVFMEYSFKDK------SQEFQKKLVDTMEKKKEDFVLQNE 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atlNP_001287506.1 GBP 14..289 CDD:280433 69/311 (22%)
MSC <316..>471 CDD:286487 23/101 (23%)
GBP7NP_997281.2 GTPase domain (Globular). /evidence=ECO:0000250 1..310 76/343 (22%)
GBP 18..281 CDD:280433 68/290 (23%)
GBP_C 283..579 CDD:202427 27/134 (20%)
GBP_C 289..579 CDD:293879 27/125 (22%)
coiled coil 548..559 CDD:293879
coiled coil 568..579 CDD:293879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142064
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2037
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027269at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.