DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atl and GBP1

DIOPT Version :9

Sequence 1:NP_001287506.1 Gene:atl / 42934 FlyBaseID:FBgn0039213 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_002044.2 Gene:GBP1 / 2633 HGNCID:4182 Length:592 Species:Homo sapiens


Alignment Length:442 Identity:101/442 - (22%)
Similarity:174/442 - (39%) Gaps:83/442 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VVSVAGAFRKGKSFLLDFFLRYMYSKYVHHDATDWLGGESDPLEGFSWRGGSERDTTGILMWSDI 104
            ||::.|.:|.|||:|:                 :.|.|:.   :|||.....:..|.||.||   
Human    40 VVAIVGLYRTGKSYLM-----------------NKLAGKK---KGFSLGSTVQSHTKGIWMW--- 81

  Fly   105 FLHDYPNGDKIAIILLDTQGAFD-SQSTVRDCATVFALSTMLSSVQIYNLSQNIQEDDLQHLQLF 168
             ...:|......::||||:|..| .:...::.:.:|||:.:|||..:||....|.:..:..|...
Human    82 -CVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYV 145

  Fly   169 TEYGRLALADTGKKP--------------FQRLQFLVRDWSFPYEAEYGALGGDKIL--KRRLEV 217
            ||......:.:....              |....:.:||:|...||:...|..|:.|  ..:|:.
Human   146 TELTHRIRSKSSPDENENEVEDSADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKK 210

  Fly   218 SDKQHPELQSL-RRHISSCFTEVACFLMPHP--GLNVATNPKFDGRLQD--ITPEFKSSLRSLVP 277
            ...|..|..:| |..|...|.:..||:...|  ...:|...|    |||  :.|||...:.....
Human   211 GTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHRRKLAQLEK----LQDEELDPEFVQQVADFCS 271

  Fly   278 MLLAPDNLVYKEISGQ-RVRARDLIQYFQSYMNIYKGNELPEPKSMLVATAEANHLTAVAAAKEL 341
            .:.:  |...|.:||. :|....|.....:|:|.....:||..::.::|.|:..:..||..|...
Human   272 YIFS--NSKTKTLSGGIQVNGPRLESLVLTYVNAISSGDLPCMENAVLALAQIENSAAVQKAIAH 334

  Fly   342 YGQLMEEVCGGTRPYLSTAHLQ---TEHLRVKDKALFQFAAKRKMGGEEFTEKFRKQLEDDLEEV 403
            |.|.|     |.:..|.|..||   ..|...:.:|:..|.   :...::....|:|:|...||:.
Human   335 YEQQM-----GQKVQLPTETLQELLDLHRDSEREAIEVFI---RSSFKDVDHLFQKELAAQLEKK 391

  Fly   404 FTNYQAHNESKNIFKAARTPAVYFACAVIMYIL---------SGIFGLVGLY 446
            ..::...|:..:..:          |:.::.::         :||:...|.|
Human   392 RDDFCKQNQEASSDR----------CSALLQVIFSPLEEEVKAGIYSKPGGY 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atlNP_001287506.1 GBP 14..289 CDD:280433 65/270 (24%)
MSC <316..>471 CDD:286487 29/143 (20%)
GBP1NP_002044.2 GTPase domain (Globular) 1..311 73/300 (24%)
GBP 18..282 CDD:280433 66/271 (24%)
GBP_C 284..580 CDD:202427 34/168 (20%)
GBP_C 290..580 CDD:293879 32/162 (20%)
coiled coil 549..560 CDD:293879
coiled coil 569..580 CDD:293879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142057
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2037
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027269at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.