DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atl and Gbp2

DIOPT Version :9

Sequence 1:NP_001287506.1 Gene:atl / 42934 FlyBaseID:FBgn0039213 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_034390.1 Gene:Gbp2 / 14469 MGIID:102772 Length:589 Species:Mus musculus


Alignment Length:445 Identity:99/445 - (22%)
Similarity:165/445 - (37%) Gaps:103/445 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EHTFVLNEDALSEVLMRDEVKDRFVCVVSVAGAFRKGKSFLLDFFLRYMYSKYVHHDATDWLGGE 78
            |...|:|::|| .:|   ....:.|.||::.|.:|.|||:|:                 :.|.|:
Mouse    18 EAQLVINQEAL-RIL---SAITQPVVVVAIVGLYRTGKSYLM-----------------NKLAGK 61

  Fly    79 SDPLEGFSWRGGSERDTTGILMWSDIFLHDYPNGDKI--AIILLDTQGAFDSQ--STVRDCATVF 139
            .   .|||.....:..|.||.||.      .|:..|.  .::||||:|..|.:  ....|| .:|
Mouse    62 R---TGFSLGSTVQSHTKGIWMWC------VPHPKKAGQTLVLLDTEGLEDVEKGDNQNDC-WIF 116

  Fly   140 ALSTMLSSVQIYNLSQNIQEDDLQHLQLFTEYGRLALADTGKKP-----------------FQRL 187
            ||:.:|||..|||....|.:..:..|...||     |.|..|..                 |...
Mouse   117 ALAVLLSSTFIYNSIGTINQQAMDQLHYVTE-----LTDLIKSKSSPDQSGVDDSANFVGFFPTF 176

  Fly   188 QFLVRDWSFPYEAEYGALGGDKILKRRLEV---SDKQHPELQSLRRHISSCFTEVACFLMPHPG- 248
            .:.:||:|...|.....:..|:.|:..|.:   :||:.......|..|...|.:..||:...|. 
Mouse   177 VWTLRDFSLELEVNGKPVTSDEYLEHSLTLKKGADKKTKSFNEPRLCIRKFFPKRKCFIFDRPAQ 241

  Fly   249 ------LNVATNPKFDGRLQDITPEFKSSLRSLVPMLLAPDNLVYKEISGQRVRARDLIQYFQSY 307
                  |......:..|...:...||.|.:.|...:......::   ::|.|:::     ..|:|
Mouse   242 RKQLSKLETLREEELCGEFVEQVAEFTSYILSYSSVKTLCGGII---VNGPRLKS-----LVQTY 298

  Fly   308 MNIYKGNELPEPKSMLVATAEANHLTAVAAAKELYGQLMEEVCGGTRPYLSTAHLQTEHLRVKDK 372
            :.......||..:|.::..|:..:..||..|...|.:.|.:..  ..|..:...|...|..::.:
Mouse   299 VGAISNGSLPCMESAVLTLAQIENSAAVQKAITHYEEQMNQKI--QMPTETLQELLDLHRPIESE 361

  Fly   373 ALFQFAAKRKMGGEEFTEKFRKQL-----------------------EDDLEEVF 404
            |:..|.   |...::..:||:.:|                       .|.||::|
Mouse   362 AIEVFL---KNSFKDVDQKFQTELGNLLVAKRDAFIKKNMDVSSARCSDLLEDIF 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atlNP_001287506.1 GBP 14..289 CDD:280433 73/305 (24%)
MSC <316..>471 CDD:286487 22/112 (20%)
Gbp2NP_034390.1 GTPase domain (Globular). /evidence=ECO:0000250 1..309 78/334 (23%)
GBP 18..280 CDD:280433 73/297 (25%)
GBP_C 282..578 CDD:202427 26/145 (18%)
GBP_C 288..578 CDD:293879 26/136 (19%)
coiled coil 547..558 CDD:293879
coiled coil 567..578 CDD:293879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832120
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2037
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027269at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.