DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atl and GBP4

DIOPT Version :9

Sequence 1:NP_001287506.1 Gene:atl / 42934 FlyBaseID:FBgn0039213 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_443173.2 Gene:GBP4 / 115361 HGNCID:20480 Length:640 Species:Homo sapiens


Alignment Length:464 Identity:107/464 - (23%)
Similarity:189/464 - (40%) Gaps:80/464 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SEEHTFVLNEDALSEVLMRDEVKDRF---VCVVSVAGAFRKGKSFLLDFFLRYMYSKYVHHDATD 73
            ::|....:|..||       |:.|:.   |.||::.|.:|.|||:|:                 :
Human    31 NQEEQLTVNSKAL-------EILDKISQPVVVVAIVGLYRTGKSYLM-----------------N 71

  Fly    74 WLGGESDPLEGFSWRGGSERDTTGILMWSDIFLHDYPNGDKIAIILLDTQGAFD-SQSTVRDCAT 137
            .|.|:.:   ||......:.:|.||.||....| ..||.   .::||||:|..| .:|..::.:.
Human    72 RLAGKRN---GFPLGSTVQSETKGIWMWCVPHL-SKPNH---TLVLLDTEGLGDVEKSNPKNDSW 129

  Fly   138 VFALSTMLSSVQIYNLSQNIQEDDLQHLQLFTEYGRLALADTGKKP------------FQRLQFL 190
            :|||:.:|||..:||....|....|:.|...||...|..|.:..:|            |....:.
Human   130 IFALAVLLSSSFVYNSVSTINHQALEQLHYVTELAELIRAKSCPRPDEAEDSSEFASFFPDFIWT 194

  Fly   191 VRDWSFPYEAEYGALGGDKILKRRLEVSDKQHPELQSL---RRHISSCFTEVACFLMPHPGLNVA 252
            |||::...:.:...:..|:.|:..|::...::|::|:.   |..|...|.:..||:...|     
Human   195 VRDFTLELKLDGNPITEDEYLENALKLIPGKNPKIQNSNMPRECIRHFFRKRKCFVFDRP----- 254

  Fly   253 TNPKFDGRLQDITPEFKSSLRSLVPMLLAPDNL---VYKEISGQRVR------ARDLIQYFQSYM 308
            ||.|......|..||......    .|:..||.   ::.....:.:|      .:.|.....:|:
Human   255 TNDKQYLNHMDEVPEENLERH----FLMQSDNFCSYIFTHAKTKTLREGIIVTGKRLGTLVVTYV 315

  Fly   309 NIYKGNELPEPKSMLVATAEANHLTAVAAAKELYGQLMEEVCGGTRPYLSTAHLQ---TEHLRVK 370
            :......:|..::.:.|.|:..:..||..|.:.|.|.|.:     :..|.|..||   ..|...:
Human   316 DAINSGAVPCLENAVTALAQLENPAAVQRAADHYSQQMAQ-----QLRLPTDTLQELLDVHAACE 375

  Fly   371 DKALFQFAAKRKMGGEEFTEKFRKQLEDDLEEVFTNYQAHNESKNIFKAARTPAVYFACAVIMYI 435
            .:|:..|   .:...::...:|:|:|.|.:|:...::...||..:. |..:......:..:...|
Human   376 REAIAVF---MEHSFKDENHEFQKKLVDTIEKKKGDFVLQNEEASA-KYCQAELKRLSEHLTESI 436

  Fly   436 LSGIFGLVG 444
            |.|||.:.|
Human   437 LRGIFSVPG 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atlNP_001287506.1 GBP 14..289 CDD:280433 74/296 (25%)
MSC <316..>471 CDD:286487 30/132 (23%)
GBP4NP_443173.2 GTPase domain (Globular). /evidence=ECO:0000250 1..325 77/333 (23%)
GBP 33..296 CDD:280433 74/302 (25%)
GBP_C 298..594 CDD:202427 32/157 (20%)
GBP_C 304..594 CDD:293879 32/151 (21%)
coiled coil 563..574 CDD:293879
coiled coil 583..594 CDD:293879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142063
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2037
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027269at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.