DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atl and LOC100334716

DIOPT Version :9

Sequence 1:NP_001287506.1 Gene:atl / 42934 FlyBaseID:FBgn0039213 Length:541 Species:Drosophila melanogaster
Sequence 2:XP_021327821.1 Gene:LOC100334716 / 100334716 -ID:- Length:284 Species:Danio rerio


Alignment Length:240 Identity:49/240 - (20%)
Similarity:83/240 - (34%) Gaps:59/240 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 KPFQRLQFLVRDWSFPYEAEYGALGGDKILKRRLEVSDKQHPELQSL---RRHISSCFTEVACFL 243
            |.|....:.|||::...:.:......|:.|:..|::......::.|.   |..|...|....||.
Zfish    47 KFFPSFIWSVRDFTLERKIDGKDATEDEYLEFALKLKPGTSKKITSFNLPRECIQKFFPSRTCFT 111

  Fly   244 MPHPGLNVATNPKFDGRLQDITPEFKSSLRSLVPMLLAPDNL---------------VYKEISGQ 293
            .|.|                ..||..|:|.||.|..|:.:.|               |.:...|.
Zfish   112 FPFP----------------TAPEKMSTLESLSPADLSTEFLEVTKRFCKFVFDKSEVKRLKDGH 160

  Fly   294 RVRARD-------------LIQYFQS----------YMNIYKGNELPEPKSMLVATAEANHLTAV 335
            .|..|.             ::..|.|          |:|......:|..::.::|.|:..:..|.
Zfish   161 TVTGRGDSKGNSKKLFYNIVVDLFSSLKVLGSLTKMYVNTISSGAVPCLENAVIAMAQIENEAAT 225

  Fly   336 AAAKELYGQLMEEVCGGTRPYLSTAHLQTEHLRVKDKALFQFAAK 380
            ....|:|.:.||:: ..:.| |....:.:||.|:...|...|.|:
Zfish   226 QEGLEVYQRGMEKL-KSSFP-LELEQVSSEHQRLSSMATQAFMAR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atlNP_001287506.1 GBP 14..289 CDD:280433 26/124 (21%)
MSC <316..>471 CDD:286487 16/65 (25%)
LOC100334716XP_021327821.1 P-loop_NTPase <18..156 CDD:328724 26/124 (21%)
GBP_C 188..>282 CDD:328214 18/83 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027269at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.