DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx18 and UFE1

DIOPT Version :9

Sequence 1:NP_524485.1 Gene:Syx18 / 42933 FlyBaseID:FBgn0039212 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_014718.1 Gene:UFE1 / 854242 SGDID:S000005601 Length:346 Species:Saccharomyces cerevisiae


Alignment Length:420 Identity:72/420 - (17%)
Similarity:154/420 - (36%) Gaps:108/420 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DITQSFKASVMTV------------RLQRKAELAGKAKPATVPTKTGPIGPKDDFAKQAKEVCNK 54
            |:|..|:..|..:            .::||.|..|.:.......       :|.|.|:...:...
Yeast     4 DLTPIFRKYVAVIDDARNEQNGIDDHVERKQEDFGNSNETCEMF-------RDSFIKECARLLKF 61

  Fly    55 ITSLRNVLIENRTAYMRIGQHLKSAAHMTDAQRDLIDRESEKFVTFYTQHLAKMRSDWKSAKRKP 119
            :..|..|:.:....|:       ...:|:||::|..|.|....:..|.:.               
Yeast    62 LVELNKVIKQIEKNYL-------DDFNMSDAEKDEFDMECRLQIQQYFKK--------------- 104

  Fly   120 QERQHIDAVLDLLVSYLHSVEQIYLDQKKYRVQHELETYRLLKLAADKK---KIPVRPAGSNSG- 180
                     .:.|.:|  .:|:..|..|::    :.:::|..|:.::|.   |..:.|....:| 
Yeast   105 ---------FEFLENY--EMERHNLSLKRF----QSKSHRWSKILSNKNDNTKHVIHPQDIENGV 154

  Fly   181 ---KLGRRQVSN-----DDSEATKSSSQA-----NGNHDESADNDWNNDAWGDWDEDEEGDEVDD 232
               :||..:..|     ..|:.|....:.     ..|.:.:.....:|:|     :|...|.:| 
Yeast   155 YEFRLGVLRCLNLWIKYVSSKFTTIQQERLILENKMNFNSTPMPTLSNNA-----DDFSADAID- 213

  Fly   233 HDGEKGKEANQANQHKPRTRKRSKANRSDLNNSSSKMALDEELQQQQEADDDDPLSAEDVQLFEA 297
                                       ..::.|:....:.:|::..:|.  ...|:.|.:|:.|.
Yeast   214 ---------------------------ISVSQSAPVETVQDEVKHYEET--ISKLTQEQLQVLET 249

  Fly   298 ENVHIYNFLQGVSEEVEQIEKNVVDIAQLQDIFTEKVAMQQHNIDRIVSAVVGTTENVKDANEQI 362
            |:..:.|......::||.|.|.::||..:|:..:..:.:|..||:.:::.......|:|..|:::
Yeast   250 EHSELLNQKNEQLKKVETINKTILDIVNIQNELSNHLTVQSQNINLMLNNQDDIELNIKKGNKEL 314

  Fly   363 RQATQRNAGLRVWSLFFLLVMSFSLLFLDW 392
            |:|.:........:.:..::|...:||||:
Yeast   315 RKAKRAAGRTAKMTTYGAIIMGVFILFLDY 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx18NP_524485.1 Syntaxin-18_N 2..90 CDD:287468 18/99 (18%)
SNARE_syntaxin18 306..364 CDD:277203 13/57 (23%)
UFE1NP_014718.1 Syntaxin-18_N 4..90 CDD:402222 18/99 (18%)
COG5325 <170..341 CDD:227635 33/205 (16%)
SNARE_syntaxin18 258..316 CDD:277203 13/57 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345788
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3894
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004915
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103713
Panther 1 1.100 - - LDO PTHR15959
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.